BLASTX nr result
ID: Coptis21_contig00038163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038163 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 108 6e-22 emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 86 1e-20 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 69 4e-10 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 108 bits (269), Expect = 6e-22 Identities = 50/58 (86%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = +2 Query: 17 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSVPESG-PPLSFDQRVLEPTCPCMELP 187 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGS PESG PP SFDQRVLEPT P ++ P Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEPTFPALDAP 58 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 85.9 bits (211), Expect(2) = 1e-20 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +3 Query: 51 GGGITPFSKEPYVTLSRHTAPSRNQDLPFPLTNGSSNQPV 170 GGGITPFSKEPYVTLSRHTAPSRN+DLPFPLTNGSSNQPV Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSNQPV 59 Score = 38.9 bits (89), Expect(2) = 1e-20 Identities = 21/29 (72%), Positives = 23/29 (79%) Frame = +2 Query: 185 PFHSFID*FKVALACFQVQALAVEASRQK 271 PF+S VA+ACFQVQALAVEASRQK Sbjct: 61 PFYS-----SVAVACFQVQALAVEASRQK 84 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 100 RESVTYGSFEKGVIPPPIRPDERSTELHPYSPG 2 RE++TYGSFEKGV PPPIRPDERSTELHPYSPG Sbjct: 880 RENLTYGSFEKGVRPPPIRPDERSTELHPYSPG 912