BLASTX nr result
ID: Coptis21_contig00038013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038013 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145327.1| PREDICTED: pentatricopeptide repeat-containi... 101 7e-20 ref|XP_002520500.1| pentatricopeptide repeat-containing protein,... 101 7e-20 ref|XP_003531885.1| PREDICTED: pentatricopeptide repeat-containi... 100 9e-20 emb|CBI16054.3| unnamed protein product [Vitis vinifera] 100 2e-19 ref|XP_002280428.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 >ref|XP_004145327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449474033|ref|XP_004154055.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] gi|449510921|ref|XP_004163811.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] Length = 649 Score = 101 bits (251), Expect = 7e-20 Identities = 55/103 (53%), Positives = 71/103 (68%), Gaps = 3/103 (2%) Frame = -3 Query: 302 PFPPKHTNTKTPTFSSLKTSPQPQQHSNNNRLIQFLCKRNNLKHALKILSNEPNPTQQTY 123 P P+++ +K + SS +P +SNNN LIQ LCK+ NLK AL +LS+E NPTQQT Sbjct: 14 PSSPRYSTSKL-SVSSFSFNPSTPPNSNNNHLIQSLCKQGNLKQALYLLSHESNPTQQTC 72 Query: 122 EHLILSCTR---LSDGVLVHHHVIDNGFDQDSFLATKVINMYT 3 E LILS R LSD + VH ++D GFDQD FLATK+INM++ Sbjct: 73 ELLILSAARRNSLSDALDVHQLLVDGGFDQDPFLATKLINMFS 115 >ref|XP_002520500.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540342|gb|EEF41913.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 414 Score = 101 bits (251), Expect = 7e-20 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 15/114 (13%) Frame = -3 Query: 299 FPPKHTNTKTPTFSSLKTSPQPQQH------------SNNNRLIQFLCKRNNLKHALKIL 156 F T+ P+ S+ + P P+ +N+N+LIQ LCK+ NLK AL +L Sbjct: 4 FHSPQATTQPPSHSTFFSRPTPKPPICFVNLNPTIPTANSNKLIQSLCKQGNLKQALNLL 63 Query: 155 SNEPNPTQQTYEHLILSCTRLS---DGVLVHHHVIDNGFDQDSFLATKVINMYT 3 NEP+P Q TYE L+LSCT + D VH H++DNGFDQD FLATK+INMY+ Sbjct: 64 CNEPDPAQHTYELLLLSCTHQNSFLDAQFVHQHLLDNGFDQDPFLATKLINMYS 117 >ref|XP_003531885.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Glycine max] Length = 658 Score = 100 bits (250), Expect = 9e-20 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 6/100 (6%) Frame = -3 Query: 287 HTNTKTP-TFSSLKTSPQ--PQQHSNNNRLIQFLCKRNNLKHALKILSNEPNPTQQTYEH 117 H +++ P +F SL S +SNNN+LIQ LCK NLK AL +L EPNPTQQT+EH Sbjct: 24 HVSSRVPVSFVSLNPSANLINDINSNNNQLIQSLCKGGNLKQALHLLCCEPNPTQQTFEH 83 Query: 116 LILSCTR---LSDGVLVHHHVIDNGFDQDSFLATKVINMY 6 LI SC + LS G+ VH ++D+GFDQD FLATK+INMY Sbjct: 84 LIYSCAQKNSLSYGLDVHRCLVDSGFDQDPFLATKLINMY 123 >emb|CBI16054.3| unnamed protein product [Vitis vinifera] Length = 476 Score = 100 bits (248), Expect = 2e-19 Identities = 57/112 (50%), Positives = 72/112 (64%), Gaps = 9/112 (8%) Frame = -3 Query: 311 PFLPFP---PKHTNTKTPTFSSLKTSPQPQQH---SNNNRLIQFLCKRNNLKHALKILSN 150 P LP P P + K +L+ S + + +NNN LIQ LCK+ NL AL++LS Sbjct: 13 PHLPKPFHKPTAISPKPQCCLALRPSTTTRSNGDSNNNNPLIQSLCKQGNLNQALQVLSQ 72 Query: 149 EPNPTQQTYEHLILSCTR---LSDGVLVHHHVIDNGFDQDSFLATKVINMYT 3 EPNPTQ TYE LILSCTR L G+ +H H+I +G DQD FLATK+INMY+ Sbjct: 73 EPNPTQHTYELLILSCTRQNSLPQGIDLHRHLIHDGSDQDPFLATKLINMYS 124 >ref|XP_002280428.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic [Vitis vinifera] Length = 658 Score = 100 bits (248), Expect = 2e-19 Identities = 57/112 (50%), Positives = 72/112 (64%), Gaps = 9/112 (8%) Frame = -3 Query: 311 PFLPFP---PKHTNTKTPTFSSLKTSPQPQQH---SNNNRLIQFLCKRNNLKHALKILSN 150 P LP P P + K +L+ S + + +NNN LIQ LCK+ NL AL++LS Sbjct: 13 PHLPKPFHKPTAISPKPQCCLALRPSTTTRSNGDSNNNNPLIQSLCKQGNLNQALQVLSQ 72 Query: 149 EPNPTQQTYEHLILSCTR---LSDGVLVHHHVIDNGFDQDSFLATKVINMYT 3 EPNPTQ TYE LILSCTR L G+ +H H+I +G DQD FLATK+INMY+ Sbjct: 73 EPNPTQHTYELLILSCTRQNSLPQGIDLHRHLIHDGSDQDPFLATKLINMYS 124