BLASTX nr result
ID: Coptis21_contig00037884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00037884 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281975.1| PREDICTED: nitrate transporter 1.4-like [Vit... 72 4e-11 emb|CBI28187.3| unnamed protein product [Vitis vinifera] 72 4e-11 ref|XP_004159415.1| PREDICTED: nitrate transporter 1.4-like [Cuc... 64 1e-08 ref|XP_004139418.1| PREDICTED: nitrate transporter 1.4-like [Cuc... 64 1e-08 gb|AFR11354.1| nitrate transporter [Cucumis sativus] 64 1e-08 >ref|XP_002281975.1| PREDICTED: nitrate transporter 1.4-like [Vitis vinifera] Length = 580 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 318 ADNINEGRLDCFYWLLAVLSFINFGFFLLCAMWYRPNKPENAL 190 ADNIN GRLDCFY LLA+LSFINF FL+CA+WY+P KP + + Sbjct: 523 ADNINYGRLDCFYGLLAILSFINFAVFLVCAVWYKPQKPNDGM 565 >emb|CBI28187.3| unnamed protein product [Vitis vinifera] Length = 576 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 318 ADNINEGRLDCFYWLLAVLSFINFGFFLLCAMWYRPNKPENAL 190 ADNIN GRLDCFY LLA+LSFINF FL+CA+WY+P KP + + Sbjct: 519 ADNINYGRLDCFYGLLAILSFINFAVFLVCAVWYKPQKPNDGM 561 >ref|XP_004159415.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus] Length = 623 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 318 ADNINEGRLDCFYWLLAVLSFINFGFFLLCAMWYRPNKPENAL 190 ADNIN RLDCFY LL +LS INF FL+CA+WY+P KP+ L Sbjct: 566 ADNINYARLDCFYGLLTILSAINFVAFLVCAIWYKPQKPKQLL 608 >ref|XP_004139418.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus] Length = 623 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 318 ADNINEGRLDCFYWLLAVLSFINFGFFLLCAMWYRPNKPENAL 190 ADNIN RLDCFY LL +LS INF FL+CA+WY+P KP+ L Sbjct: 566 ADNINYARLDCFYGLLTILSTINFVAFLVCAIWYKPQKPKQLL 608 >gb|AFR11354.1| nitrate transporter [Cucumis sativus] Length = 581 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 318 ADNINEGRLDCFYWLLAVLSFINFGFFLLCAMWYRPNKPENAL 190 ADNIN RLDCFY LL +LS INF FL+CA+WY+P KP+ L Sbjct: 524 ADNINYARLDCFYGLLTILSAINFVAFLVCAIWYKPQKPKQLL 566