BLASTX nr result
ID: Coptis21_contig00037830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00037830 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus ... 56 3e-06 >ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527546|gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 389 Score = 55.8 bits (133), Expect = 3e-06 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 6/70 (8%) Frame = +3 Query: 6 SVYGICSNASVKDYEVVEISLFLKRD-----SEVTVYSLRRNSWRTIQVFPYAI-PTGRG 167 SV+G + S DY++V I+ F D SEV V+SLR+NSWR I PY + G Sbjct: 140 SVFGFGYDLSNDDYKLVRIAQFGGVDRKSFESEVKVFSLRKNSWRRIADMPYCVLYPGEN 199 Query: 168 GVIINGALHW 197 G+ NGALHW Sbjct: 200 GIYANGALHW 209