BLASTX nr result
ID: Coptis21_contig00037697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00037697 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 107 1e-21 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 104 7e-21 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 100 9e-20 ref|XP_003567522.1| PREDICTED: pentatricopeptide repeat-containi... 98 8e-19 ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|2... 97 1e-18 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 107 bits (267), Expect = 1e-21 Identities = 51/95 (53%), Positives = 70/95 (73%) Frame = +2 Query: 2 QGHCQACDIDQAMKCFTKMLEKKVDVDANVLEVLVNGLCGQGRVDGAYNLGIEMIDKADM 181 QGHC A ++D+A+ CF KM+EK D DA++LEVL+NG Q R+DGAY L +EM++ A + Sbjct: 450 QGHCAAKEVDKALICFAKMMEKNCDADADLLEVLINGFLSQKRIDGAYKLLVEMVNTAHL 509 Query: 182 RPLEATYNNLIHILLQERKVKEATNLLCLMKKHNF 286 P +ATY +I+ LL RK++EA NLL LMKK N+ Sbjct: 510 VPWQATYKLMINKLLGVRKLEEAINLLHLMKKQNY 544 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 104 bits (260), Expect = 7e-21 Identities = 50/94 (53%), Positives = 68/94 (72%) Frame = +2 Query: 2 QGHCQACDIDQAMKCFTKMLEKKVDVDANVLEVLVNGLCGQGRVDGAYNLGIEMIDKADM 181 QGHC A ++ +A+ C KM+EK D DA++L VL+N Q R+DGAY L ++M+DKA + Sbjct: 448 QGHCVANEVGKALMCLAKMMEKHCDPDADLLAVLINAFLSQKRIDGAYTLFMDMVDKARL 507 Query: 182 RPLEATYNNLIHILLQERKVKEATNLLCLMKKHN 283 RP +ATY LI LL+ RK++EA NLL LMK+HN Sbjct: 508 RPWQATYKLLIEKLLEVRKLEEALNLLRLMKQHN 541 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 100 bits (250), Expect = 9e-20 Identities = 49/95 (51%), Positives = 69/95 (72%) Frame = +2 Query: 2 QGHCQACDIDQAMKCFTKMLEKKVDVDANVLEVLVNGLCGQGRVDGAYNLGIEMIDKADM 181 QGHC A ++D A+ CF KM+EK D DA++L+VL++G Q +++GAY L IE+ +KA + Sbjct: 443 QGHCNANELDIALVCFAKMIEKNCDPDADLLDVLISGFLNQKKLNGAYQLLIELTNKAHV 502 Query: 182 RPLEATYNNLIHILLQERKVKEATNLLCLMKKHNF 286 RP +ATY LI LL+ RK++EA LL LMKK N+ Sbjct: 503 RPWQATYKQLIKNLLEVRKLEEAIALLRLMKKQNY 537 >ref|XP_003567522.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Brachypodium distachyon] Length = 585 Score = 97.8 bits (242), Expect = 8e-19 Identities = 44/95 (46%), Positives = 67/95 (70%) Frame = +2 Query: 2 QGHCQACDIDQAMKCFTKMLEKKVDVDANVLEVLVNGLCGQGRVDGAYNLGIEMIDKADM 181 QGHC A ++D+A++ T+M+E +D DA++L+V+V GLC Q +VD AY L +EM+DKA + Sbjct: 405 QGHCTAGEVDKALQYLTEMIENNLDADADLLDVMVRGLCNQDKVDAAYTLFVEMVDKAQL 464 Query: 182 RPLEATYNNLIHILLQERKVKEATNLLCLMKKHNF 286 P + TY ++I LL+ +K++EA LL MK F Sbjct: 465 NPWQGTYKHIISELLRVKKLEEALGLLKSMKARKF 499 >ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|222868635|gb|EEF05766.1| predicted protein [Populus trichocarpa] Length = 476 Score = 97.4 bits (241), Expect = 1e-18 Identities = 48/95 (50%), Positives = 65/95 (68%) Frame = +2 Query: 2 QGHCQACDIDQAMKCFTKMLEKKVDVDANVLEVLVNGLCGQGRVDGAYNLGIEMIDKADM 181 QGH A +D+ + C KM EK D DA++L+VLV G Q ++DGAY +EM++K + Sbjct: 297 QGHFAANQVDKGLLCLVKMTEKNTDPDADLLDVLVKGFLSQRKMDGAYTFLVEMVNKLRL 356 Query: 182 RPLEATYNNLIHILLQERKVKEATNLLCLMKKHNF 286 P +ATY LI LLQ RK++EAT+LL LMKKHN+ Sbjct: 357 VPWQATYKLLIEKLLQVRKLEEATDLLRLMKKHNY 391