BLASTX nr result
ID: Coptis21_contig00037340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00037340 (592 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588321.1| hypothetical protein ZeamMp058 [Zea mays subsp.... 70 4e-10 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 49 9e-10 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 64 2e-08 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|YP_588321.1| hypothetical protein ZeamMp058 [Zea mays subsp. mays] gi|40795110|gb|AAR91154.1| hypothetical protein (mitochondrion) [Zea mays] gi|413954039|gb|AFW86688.1| putative uncharacterized protein orf109-a [Zea mays] gi|413954253|gb|AFW86902.1| putative uncharacterized protein orf109-a [Zea mays] gi|414888179|tpg|DAA64193.1| TPA: putative uncharacterized protein orf109-a [Zea mays] Length = 109 Score = 69.7 bits (169), Expect = 4e-10 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = -1 Query: 178 ISITHRRLVRTEGQCPP*PKWAYQRSNCLFLLRFAFVQRPRSRKRQLSFERKRSHP 11 +SITH RLVRTEGQCPP + A+QRSNC + RFAFVQ PR R+LSF KR P Sbjct: 1 MSITHLRLVRTEGQCPP--RRAHQRSNCYLIGRFAFVQGPRCWNRRLSFSSKRPTP 54 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 48.5 bits (114), Expect(2) = 9e-10 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = -2 Query: 321 LRWSS--LIFPNVQSCSGLRKEHRPSALNE 238 +RWSS + FPNV+SCSGLRKEHRPS LNE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 Score = 40.0 bits (92), Expect(2) = 9e-10 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -1 Query: 424 MLLPADQAATLLVIGVSGKPLTFGSDK*SPLGRFAQM 314 MLLPA AA +S KPL+FGSDK SP GRFAQ+ Sbjct: 1 MLLPASDAAR---DRLSFKPLSFGSDKSSPFGRFAQV 34 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = +1 Query: 433 MGQRIKRFDFVPRDPPQVGFASRVMGYYPARFGE 534 MGQRIKRFDFV RD PQVGF SRVMG YPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = -2 Query: 576 LDRGAYIHQRRLQVLPEPCWIVTHHTARKPNLW-WIPGDKVKALDPLPHTWRCSSPPIK 403 L RG I Q RL+VL EPC I+T++T GD VKALDPLPHT + SS PIK Sbjct: 14 LTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72