BLASTX nr result
ID: Coptis21_contig00036874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036874 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167748.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 58 9e-07 ref|XP_004144071.1| PREDICTED: uncharacterized protein LOC101217... 58 9e-07 ref|XP_002864462.1| hypothetical protein ARALYDRAFT_495743 [Arab... 58 9e-07 ref|NP_200464.1| uncharacterized protein [Arabidopsis thaliana] ... 58 9e-07 ref|XP_002523418.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_004167748.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101217988, partial [Cucumis sativus] Length = 406 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = -3 Query: 133 PKRRVLWMQIGDGYAQGYWPFVFFSYLATSTSVI*RGGEIVNS 5 PK WMQ G+GY GYWP FSYLA S S+I GGE+VNS Sbjct: 299 PKEGHWWMQFGNGYVMGYWPSFLFSYLADSASMIEWGGEVVNS 341 >ref|XP_004144071.1| PREDICTED: uncharacterized protein LOC101217988 [Cucumis sativus] Length = 422 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = -3 Query: 133 PKRRVLWMQIGDGYAQGYWPFVFFSYLATSTSVI*RGGEIVNS 5 PK WMQ G+GY GYWP FSYLA S S+I GGE+VNS Sbjct: 299 PKEGHWWMQFGNGYVMGYWPSFLFSYLADSASMIEWGGEVVNS 341 >ref|XP_002864462.1| hypothetical protein ARALYDRAFT_495743 [Arabidopsis lyrata subsp. lyrata] gi|297310297|gb|EFH40721.1| hypothetical protein ARALYDRAFT_495743 [Arabidopsis lyrata subsp. lyrata] Length = 421 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -3 Query: 133 PKRRVLWMQIGDGYAQGYWPFVFFSYLATSTSVI*RGGEIVN 8 PK WMQ GDGY GYWP FSYLA S S++ GGE+VN Sbjct: 298 PKEGHWWMQFGDGYVLGYWPSFLFSYLADSASIVEWGGEVVN 339 >ref|NP_200464.1| uncharacterized protein [Arabidopsis thaliana] gi|334188448|ref|NP_001190555.1| uncharacterized protein [Arabidopsis thaliana] gi|8809628|dbj|BAA97179.1| unnamed protein product [Arabidopsis thaliana] gi|17381170|gb|AAL36397.1| unknown protein [Arabidopsis thaliana] gi|23296886|gb|AAN13196.1| unknown protein [Arabidopsis thaliana] gi|332009394|gb|AED96777.1| uncharacterized protein [Arabidopsis thaliana] gi|332009395|gb|AED96778.1| uncharacterized protein [Arabidopsis thaliana] Length = 420 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = -3 Query: 133 PKRRVLWMQIGDGYAQGYWPFVFFSYLATSTSVI*RGGEIVN 8 PK WMQ GDGY GYWP FSYLA S S++ GGE+VN Sbjct: 297 PKEGHWWMQFGDGYVLGYWPSFLFSYLADSASIVEWGGEVVN 338 >ref|XP_002523418.1| conserved hypothetical protein [Ricinus communis] gi|223537368|gb|EEF38997.1| conserved hypothetical protein [Ricinus communis] Length = 412 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = -3 Query: 160 SNAPIGLSGPKRRVLWMQIGDGYAQGYWPFVFFSYLATSTSVI*RGGEIVNS 5 S I + PK WMQ G+ Y GYWP FSYLA S S+I GGE+VNS Sbjct: 280 SQYDISILDPKEGHWWMQFGNDYVLGYWPSFLFSYLADSASMIEWGGEVVNS 331