BLASTX nr result
ID: Coptis21_contig00036741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036741 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325063.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002325063.1| predicted protein [Populus trichocarpa] gi|222866497|gb|EEF03628.1| predicted protein [Populus trichocarpa] Length = 125 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = -2 Query: 141 DDWVSLSRLKRVVKKVRFILNFNINRWRLSSIIGSTSQRR--LSFNDR 4 D W LSRL R +KKV+ ILN +++RWRL+S+IG+ S RR LSFNDR Sbjct: 4 DKWSLLSRLTRAIKKVKIILNLDMSRWRLASMIGAASSRRHQLSFNDR 51