BLASTX nr result
ID: Coptis21_contig00036559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036559 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527799.1| conserved hypothetical protein [Ricinus comm... 71 8e-11 ref|XP_002515665.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002527799.1| conserved hypothetical protein [Ricinus communis] gi|223532834|gb|EEF34609.1| conserved hypothetical protein [Ricinus communis] Length = 231 Score = 71.2 bits (173), Expect = 8e-11 Identities = 30/53 (56%), Positives = 42/53 (79%) Frame = +1 Query: 133 FLAFCRHHRKNRAFYAKRIPCNVVMMNSDGEMDILNKLPMIDKGDNTPGDSPA 291 ++ F RH +K+R F+AKRIPCN+V+MN +GE D++ PMID G+ TPG+SPA Sbjct: 159 WVIFDRHQKKDREFFAKRIPCNMVVMNENGEADMIRGQPMIDNGEFTPGESPA 211 >ref|XP_002515665.1| conserved hypothetical protein [Ricinus communis] gi|223545208|gb|EEF46717.1| conserved hypothetical protein [Ricinus communis] Length = 245 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +1 Query: 133 FLAFCRHHRKNRAFYAKRIPCNVVMMNSDGEMDILNKLPMIDKGDNTPGDSP 288 F+ RH RKN+AF+A+R+P +VVMM S G++D+L ID + TPG SP Sbjct: 174 FVVLDRHLRKNKAFFAQRLPSSVVMMKSGGDVDMLKIRSSIDSSELTPGKSP 225