BLASTX nr result
ID: Coptis21_contig00036434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036434 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282375.1| PREDICTED: probable RNA 3'-terminal phosphat... 75 7e-12 ref|XP_002313504.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|NP_001242399.1| uncharacterized protein LOC100778883 [Glycin... 62 6e-08 ref|XP_003517055.1| PREDICTED: LOW QUALITY PROTEIN: probable RNA... 60 2e-07 ref|XP_002534151.1| RNA 3' terminal phosphate cyclase, putative ... 59 3e-07 >ref|XP_002282375.1| PREDICTED: probable RNA 3'-terminal phosphate cyclase-like protein [Vitis vinifera] gi|296087784|emb|CBI35040.3| unnamed protein product [Vitis vinifera] Length = 376 Score = 74.7 bits (182), Expect = 7e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 109 PVLIDDIRHEDTWPGLRPHEISLLRLLEKITDDCIVEI 222 PVLIDDIRH+DTWPGLRP+E+SLLRL EKI DDC+VEI Sbjct: 28 PVLIDDIRHDDTWPGLRPYEVSLLRLFEKICDDCVVEI 65 >ref|XP_002313504.1| predicted protein [Populus trichocarpa] gi|222849912|gb|EEE87459.1| predicted protein [Populus trichocarpa] Length = 340 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 109 PVLIDDIRHEDTWPGLRPHEISLLRLLEKITDDCIVEI 222 PV ++DIR D PGLRPHE+SLLRLLEKI+DDC+V+I Sbjct: 28 PVQVEDIRANDMMPGLRPHEVSLLRLLEKISDDCVVKI 65 >ref|NP_001242399.1| uncharacterized protein LOC100778883 [Glycine max] gi|255636967|gb|ACU18816.1| unknown [Glycine max] Length = 379 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +1 Query: 109 PVLIDDIRHEDTWPGLRPHEISLLRLLEKITDDCIVEI 222 P+LI+DIR ++TWPGLR HEISLLRL E + DDC VEI Sbjct: 28 PILIEDIRADETWPGLRNHEISLLRLFETVCDDCHVEI 65 >ref|XP_003517055.1| PREDICTED: LOW QUALITY PROTEIN: probable RNA 3'-terminal phosphate cyclase-like protein-like [Glycine max] Length = 379 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 109 PVLIDDIRHEDTWPGLRPHEISLLRLLEKITDDCIVE 219 P+LI+DIR ++TWPGLR HEISLLRL E + DDC VE Sbjct: 28 PILIEDIRADETWPGLRNHEISLLRLFETVCDDCQVE 64 >ref|XP_002534151.1| RNA 3' terminal phosphate cyclase, putative [Ricinus communis] gi|223525786|gb|EEF28234.1| RNA 3' terminal phosphate cyclase, putative [Ricinus communis] Length = 377 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 109 PVLIDDIRHEDTWPGLRPHEISLLRLLEKITDDCIVEI 222 P+LI+DIR +DT PGLR HE+S LRLLE+I+DDC +EI Sbjct: 28 PLLIEDIRADDTLPGLRSHEVSFLRLLERISDDCHIEI 65