BLASTX nr result
ID: Coptis21_contig00036432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036432 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529601.1| Kinesin-II 85 kDa subunit, putative [Ricinus... 55 6e-06 >ref|XP_002529601.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis] gi|223530934|gb|EEF32793.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis] Length = 1051 Score = 55.1 bits (131), Expect = 6e-06 Identities = 40/113 (35%), Positives = 59/113 (52%) Frame = +1 Query: 1 LRETCELYKKTVQEFQSLKTENEELMFQKIQEQNEVAEFRMKVQESFQLHEKTLKELQHM 180 L ET +LY+K E S + E+E F+ ++EQ + A K L + Q Sbjct: 599 LEETRQLYEKKTAEL-SKQLEDEHARFEGLEEQLDQAN-------------KLLSDGQ-- 642 Query: 181 SRKNEDLISEKIQGENEIKKLTVKLQEMSNLHEKTVSELQSLQADQKTLLSEK 339 + I+ EI++L KLQEM LH+ T++ELQSL++D+K LL EK Sbjct: 643 ---------DSIEDLEEIEELKGKLQEMYQLHDNTINELQSLKSDKKDLLQEK 686