BLASTX nr result
ID: Coptis21_contig00036291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036291 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65855.1| hypothetical protein VITISV_013124 [Vitis vinifera] 55 8e-06 >emb|CAN65855.1| hypothetical protein VITISV_013124 [Vitis vinifera] Length = 456 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 96 CQICNRPGHLAIDCYQRMNHAFMGRHPPAKL 4 CQIC R H A+DCY RMN+AF GRHPP +L Sbjct: 288 CQICKRENHQALDCYNRMNYAFQGRHPPIEL 318