BLASTX nr result
ID: Coptis21_contig00036240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036240 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268899.2| PREDICTED: DNA repair protein REV1-like [Vit... 59 4e-07 emb|CBI22513.3| unnamed protein product [Vitis vinifera] 59 4e-07 emb|CAN67721.1| hypothetical protein VITISV_006020 [Vitis vinifera] 59 4e-07 ref|XP_002313880.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_002518660.1| terminal deoxycytidyl transferase rev1, puta... 56 3e-06 >ref|XP_002268899.2| PREDICTED: DNA repair protein REV1-like [Vitis vinifera] Length = 1175 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 138 QVEGFLAELPIKALPGIGHVLEEKLKRLHIQTCGLLRTFSK 260 +V+ +L +LPIKALPGIGHVLEEKL+R + TCG LR SK Sbjct: 561 KVDDYLHQLPIKALPGIGHVLEEKLRRRKVHTCGQLRMISK 601 >emb|CBI22513.3| unnamed protein product [Vitis vinifera] Length = 1123 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 138 QVEGFLAELPIKALPGIGHVLEEKLKRLHIQTCGLLRTFSK 260 +V+ +L +LPIKALPGIGHVLEEKL+R + TCG LR SK Sbjct: 539 KVDDYLHQLPIKALPGIGHVLEEKLRRRKVHTCGQLRMISK 579 >emb|CAN67721.1| hypothetical protein VITISV_006020 [Vitis vinifera] Length = 500 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 138 QVEGFLAELPIKALPGIGHVLEEKLKRLHIQTCGLLRTFSK 260 +V+ +L +LPIKALPGIGHVLEEKL+R + TCG LR SK Sbjct: 414 KVDDYLHQLPIKALPGIGHVLEEKLRRRKVHTCGQLRMISK 454 >ref|XP_002313880.1| predicted protein [Populus trichocarpa] gi|222850288|gb|EEE87835.1| predicted protein [Populus trichocarpa] Length = 1191 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +3 Query: 135 LQVEGFLAELPIKALPGIGHVLEEKLKRLHIQTCGLLRTFSK 260 + V+ +L +LPIKALPGIGHVLEEKLK+ ++ TCG LR SK Sbjct: 604 VSVDEYLHKLPIKALPGIGHVLEEKLKKQNVWTCGQLRLISK 645 >ref|XP_002518660.1| terminal deoxycytidyl transferase rev1, putative [Ricinus communis] gi|223542041|gb|EEF43585.1| terminal deoxycytidyl transferase rev1, putative [Ricinus communis] Length = 1200 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 138 QVEGFLAELPIKALPGIGHVLEEKLKRLHIQTCGLLRTFSK 260 +V+ +L EL IK LPGIGHVLEEKLK+ +++TCG LR SK Sbjct: 530 KVDEYLNELSIKTLPGIGHVLEEKLKKKNVRTCGQLRLISK 570