BLASTX nr result
ID: Coptis21_contig00036118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036118 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADG39324.1| AT5G64410-like protein [Capsella grandiflora] gi|... 117 1e-28 ref|XP_003631708.1| PREDICTED: oligopeptide transporter 4 isofor... 111 2e-28 ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 isofor... 111 2e-28 ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2-like [... 114 2e-28 gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana] 116 2e-28 >gb|ADG39324.1| AT5G64410-like protein [Capsella grandiflora] gi|295831313|gb|ADG39325.1| AT5G64410-like protein [Capsella grandiflora] gi|295831315|gb|ADG39326.1| AT5G64410-like protein [Capsella grandiflora] gi|295831317|gb|ADG39327.1| AT5G64410-like protein [Capsella grandiflora] gi|295831319|gb|ADG39328.1| AT5G64410-like protein [Capsella grandiflora] gi|295831321|gb|ADG39329.1| AT5G64410-like protein [Capsella grandiflora] gi|295831323|gb|ADG39330.1| AT5G64410-like protein [Neslia paniculata] Length = 150 Score = 117 bits (293), Expect(2) = 1e-28 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +2 Query: 59 PNSPWTCPGDRVFFDASVLWGLVGPKRIFGSPGNYGALNWFFLGGLLGPALVWLLHLA 232 PNSPWTCPGDRVFFDASV+WGLVGPKRIFGS GNY A+NWFFLGG LGP LVW LH A Sbjct: 22 PNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVLVWSLHKA 79 Score = 33.9 bits (76), Expect(2) = 1e-28 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 1 AWWLLTTIPNICQHELLP 54 AWW L +I NICQ ELLP Sbjct: 4 AWWQLNSIKNICQEELLP 21 >ref|XP_003631708.1| PREDICTED: oligopeptide transporter 4 isoform 2 [Vitis vinifera] Length = 751 Score = 111 bits (277), Expect(2) = 2e-28 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +2 Query: 59 PNSPWTCPGDRVFFDASVLWGLVGPKRIFGSPGNYGALNWFFLGGLLGPALVWLLHLA 232 P+SPWTCPGDRVFFDASV+WGLVGPKRIFGS GNY ++NWFFLGG LGP +VW+ H A Sbjct: 580 PDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKA 637 Score = 39.3 bits (90), Expect(2) = 2e-28 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 1 AWWLLTTIPNICQHELLP 54 AWWLLTTI NICQ ELLP Sbjct: 562 AWWLLTTIKNICQDELLP 579 >ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 isoform 1 [Vitis vinifera] Length = 744 Score = 111 bits (277), Expect(2) = 2e-28 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +2 Query: 59 PNSPWTCPGDRVFFDASVLWGLVGPKRIFGSPGNYGALNWFFLGGLLGPALVWLLHLA 232 P+SPWTCPGDRVFFDASV+WGLVGPKRIFGS GNY ++NWFFLGG LGP +VW+ H A Sbjct: 573 PDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKA 630 Score = 39.3 bits (90), Expect(2) = 2e-28 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 1 AWWLLTTIPNICQHELLP 54 AWWLLTTI NICQ ELLP Sbjct: 555 AWWLLTTIKNICQDELLP 572 >ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus] gi|449515718|ref|XP_004164895.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus] Length = 742 Score = 114 bits (284), Expect(2) = 2e-28 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +2 Query: 59 PNSPWTCPGDRVFFDASVLWGLVGPKRIFGSPGNYGALNWFFLGGLLGPALVWLL 223 PNSPWTCPGDRVFFDASV+WGLVGPKRIFGS GNY ALNWFF+GG +GP LVWLL Sbjct: 571 PNSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYAALNWFFIGGAIGPILVWLL 625 Score = 36.6 bits (83), Expect(2) = 2e-28 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 1 AWWLLTTIPNICQHELLP 54 AWWLLT+I NICQ +LLP Sbjct: 553 AWWLLTSIENICQDQLLP 570 >gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana] Length = 729 Score = 116 bits (291), Expect(2) = 2e-28 Identities = 49/58 (84%), Positives = 52/58 (89%) Frame = +2 Query: 59 PNSPWTCPGDRVFFDASVLWGLVGPKRIFGSPGNYGALNWFFLGGLLGPALVWLLHLA 232 PNSPWTCPGDRVFFDASV+WGLVGPKRIFGS GNY A+NWFFLGG LGP +VW LH A Sbjct: 558 PNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKA 615 Score = 33.9 bits (76), Expect(2) = 2e-28 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 1 AWWLLTTIPNICQHELLP 54 AWW L +I NICQ ELLP Sbjct: 540 AWWQLNSIKNICQEELLP 557