BLASTX nr result
ID: Coptis21_contig00035980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035980 (376 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19761.3| unnamed protein product [Vitis vinifera] 105 3e-21 ref|XP_002464628.1| hypothetical protein SORBIDRAFT_01g022060 [S... 105 3e-21 ref|XP_002281008.1| PREDICTED: ribosomal RNA small subunit methy... 105 3e-21 gb|AAV64189.1| hypothetical protein F9002 [Zea mays] 104 7e-21 gb|AAV64227.1| hypothetical protein F9002 [Zea mays] 104 7e-21 >emb|CBI19761.3| unnamed protein product [Vitis vinifera] Length = 374 Score = 105 bits (263), Expect = 3e-21 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = +2 Query: 2 GSLKSGLYLVATPIGNLEDITFRALRVLKSANVILSEDTRHSGKLLQHYNIKTPLLSF 175 G LK GLYLV TPIGNLEDITFRALRVL+SANVILSEDTRHSGKLLQHY+IKTPLLS+ Sbjct: 85 GHLKPGLYLVGTPIGNLEDITFRALRVLRSANVILSEDTRHSGKLLQHYDIKTPLLSY 142 >ref|XP_002464628.1| hypothetical protein SORBIDRAFT_01g022060 [Sorghum bicolor] gi|241918482|gb|EER91626.1| hypothetical protein SORBIDRAFT_01g022060 [Sorghum bicolor] Length = 336 Score = 105 bits (263), Expect = 3e-21 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +2 Query: 8 LKSGLYLVATPIGNLEDITFRALRVLKSANVILSEDTRHSGKLLQHYNIKTPLLSF 175 L+SGLYLVATPIGNLEDIT RALRVLK ANVILSEDTRHSGKLLQHYNIKTPLLSF Sbjct: 58 LESGLYLVATPIGNLEDITLRALRVLKCANVILSEDTRHSGKLLQHYNIKTPLLSF 113 >ref|XP_002281008.1| PREDICTED: ribosomal RNA small subunit methyltransferase I-like [Vitis vinifera] Length = 351 Score = 105 bits (263), Expect = 3e-21 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = +2 Query: 2 GSLKSGLYLVATPIGNLEDITFRALRVLKSANVILSEDTRHSGKLLQHYNIKTPLLSF 175 G LK GLYLV TPIGNLEDITFRALRVL+SANVILSEDTRHSGKLLQHY+IKTPLLS+ Sbjct: 62 GHLKPGLYLVGTPIGNLEDITFRALRVLRSANVILSEDTRHSGKLLQHYDIKTPLLSY 119 >gb|AAV64189.1| hypothetical protein F9002 [Zea mays] Length = 337 Score = 104 bits (260), Expect = 7e-21 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +2 Query: 8 LKSGLYLVATPIGNLEDITFRALRVLKSANVILSEDTRHSGKLLQHYNIKTPLLSF 175 L+SGLYLV+TPIGNLEDIT RALRVLK ANVILSEDTRHSGKLLQHYNIKTPLLSF Sbjct: 45 LESGLYLVSTPIGNLEDITLRALRVLKCANVILSEDTRHSGKLLQHYNIKTPLLSF 100 >gb|AAV64227.1| hypothetical protein F9002 [Zea mays] Length = 337 Score = 104 bits (260), Expect = 7e-21 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +2 Query: 8 LKSGLYLVATPIGNLEDITFRALRVLKSANVILSEDTRHSGKLLQHYNIKTPLLSF 175 L+SGLYLV+TPIGNLEDIT RALRVLK ANVILSEDTRHSGKLLQHYNIKTPLLSF Sbjct: 45 LESGLYLVSTPIGNLEDITLRALRVLKCANVILSEDTRHSGKLLQHYNIKTPLLSF 100