BLASTX nr result
ID: Coptis21_contig00035796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035796 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326676.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_002326676.1| predicted protein [Populus trichocarpa] gi|222833998|gb|EEE72475.1| predicted protein [Populus trichocarpa] Length = 1224 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -3 Query: 229 RDDDSLDLIFTFLWSFSHKVILSKHFDLDSETGAEICLAAYEALVPVLKAVASS 68 + D L ++ FLW F K + S DSE GAEICLAAYEAL PVL+A+ S+ Sbjct: 348 KSDVKLSSVWNFLWKFFWKTVSSP--TCDSEAGAEICLAAYEALAPVLRALVST 399