BLASTX nr result
ID: Coptis21_contig00035495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035495 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276453.1| PREDICTED: pentatricopeptide repeat-containi... 88 8e-16 emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera] 88 8e-16 ref|XP_004144290.1| PREDICTED: pentatricopeptide repeat-containi... 85 7e-15 ref|NP_201359.1| pentatricopeptide repeat-containing protein [Ar... 78 9e-13 ref|XP_002882332.1| hypothetical protein ARALYDRAFT_896436 [Arab... 77 2e-12 >ref|XP_002276453.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|296084392|emb|CBI24780.3| unnamed protein product [Vitis vinifera] Length = 890 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/73 (58%), Positives = 54/73 (73%), Gaps = 2/73 (2%) Frame = +2 Query: 86 QLNSLLTHPNWQKNPSLQKLTSSLTPFHVS--LNVNIDPKTALSFSNWVGNRHGYSHDVK 259 QL S+L+ PNWQK+PSL+KL SLTP HVS N+DP+TALSF NW+ R G+ H+V Sbjct: 43 QLLSILSRPNWQKHPSLRKLLPSLTPSHVSSLFAFNLDPQTALSFFNWIALRPGFKHNVH 102 Query: 260 CYLSLLNLLIHAR 298 Y S+LN+LI AR Sbjct: 103 SYSSMLNILIRAR 115 >emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera] Length = 1099 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/73 (58%), Positives = 54/73 (73%), Gaps = 2/73 (2%) Frame = +2 Query: 86 QLNSLLTHPNWQKNPSLQKLTSSLTPFHVS--LNVNIDPKTALSFSNWVGNRHGYSHDVK 259 QL S+L+ PNWQK+PSL+KL SLTP HVS N+DP+TALSF NW+ R G+ H+V Sbjct: 43 QLLSILSRPNWQKHPSLRKLLPSLTPSHVSSLFAFNLDPQTALSFFNWIALRPGFKHNVH 102 Query: 260 CYLSLLNLLIHAR 298 Y S+LN+LI AR Sbjct: 103 SYSSMLNILIRAR 115 >ref|XP_004144290.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] gi|449522905|ref|XP_004168466.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Length = 915 Score = 84.7 bits (208), Expect = 7e-15 Identities = 35/70 (50%), Positives = 55/70 (78%), Gaps = 2/70 (2%) Frame = +2 Query: 86 QLNSLLTHPNWQKNPSLQKLTSSLTPFHVS--LNVNIDPKTALSFSNWVGNRHGYSHDVK 259 QL S+L+ PNWQK+PSL+ L S+ P H+S +N+DP+TAL+F NW+G +HG+ H+V+ Sbjct: 52 QLFSILSRPNWQKHPSLKNLIPSIAPSHISALFALNLDPQTALAFFNWIGQKHGFKHNVQ 111 Query: 260 CYLSLLNLLI 289 ++S+LN+L+ Sbjct: 112 SHVSMLNILV 121 >ref|NP_201359.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180383|sp|Q9LSL9.1|PP445_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g65560 gi|8978284|dbj|BAA98175.1| unnamed protein product [Arabidopsis thaliana] gi|110737310|dbj|BAF00601.1| hypothetical protein [Arabidopsis thaliana] gi|332010688|gb|AED98071.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 915 Score = 77.8 bits (190), Expect = 9e-13 Identities = 36/75 (48%), Positives = 53/75 (70%), Gaps = 2/75 (2%) Frame = +2 Query: 74 SPTHQLNSLLTHPNWQKNPSLQKLTSSLTPFHVS--LNVNIDPKTALSFSNWVGNRHGYS 247 S H+L S+L+ PNW K+PSL+ + S+++P HVS ++++DPKTAL+FS+W+ Y Sbjct: 61 SVPHRLLSILSKPNWHKSPSLKSMVSAISPSHVSSLFSLDLDPKTALNFSHWISQNPRYK 120 Query: 248 HDVKCYLSLLNLLIH 292 H V Y SLL LLI+ Sbjct: 121 HSVYSYASLLTLLIN 135 >ref|XP_002882332.1| hypothetical protein ARALYDRAFT_896436 [Arabidopsis lyrata subsp. lyrata] gi|297328172|gb|EFH58591.1| hypothetical protein ARALYDRAFT_896436 [Arabidopsis lyrata subsp. lyrata] Length = 790 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/77 (46%), Positives = 48/77 (62%), Gaps = 2/77 (2%) Frame = +2 Query: 68 PDSPTHQLNSLLTHPNWQKNPSLQKLTSSLTPFHVS--LNVNIDPKTALSFSNWVGNRHG 241 P H L S+L+ PNWQ NPSL+ L ++TP HVS ++N+DP TAL FS W+ Sbjct: 37 PSHLPHHLLSILSKPNWQNNPSLKSLLPAITPSHVSSLFSLNLDPHTALQFSYWISQTPN 96 Query: 242 YSHDVKCYLSLLNLLIH 292 + H+V Y SLL L+ H Sbjct: 97 FKHNVDSYASLLTLIDH 113