BLASTX nr result
ID: Coptis21_contig00035367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035367 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17500.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002266464.1| PREDICTED: laccase-11 [Vitis vinifera] 77 1e-12 emb|CAN71338.1| hypothetical protein VITISV_008643 [Vitis vinifera] 77 1e-12 ref|XP_002512915.1| laccase, putative [Ricinus communis] gi|2235... 73 3e-11 gb|ACN39933.1| unknown [Picea sitchensis] 72 4e-11 >emb|CBI17500.3| unnamed protein product [Vitis vinifera] Length = 542 Score = 77.0 bits (188), Expect = 1e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 278 PGVWFMHCHLELHTGWGLKMAFVVEDGTGPNQSV 177 PGVWFMHCHLELHTGWGLKMAFVVEDG GP+QSV Sbjct: 499 PGVWFMHCHLELHTGWGLKMAFVVEDGEGPDQSV 532 >ref|XP_002266464.1| PREDICTED: laccase-11 [Vitis vinifera] Length = 563 Score = 77.0 bits (188), Expect = 1e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 278 PGVWFMHCHLELHTGWGLKMAFVVEDGTGPNQSV 177 PGVWFMHCHLELHTGWGLKMAFVVEDG GP+QSV Sbjct: 520 PGVWFMHCHLELHTGWGLKMAFVVEDGEGPDQSV 553 >emb|CAN71338.1| hypothetical protein VITISV_008643 [Vitis vinifera] Length = 553 Score = 77.0 bits (188), Expect = 1e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 278 PGVWFMHCHLELHTGWGLKMAFVVEDGTGPNQSV 177 PGVWFMHCHLELHTGWGLKMAFVVEDG GP+QSV Sbjct: 510 PGVWFMHCHLELHTGWGLKMAFVVEDGEGPDQSV 543 >ref|XP_002512915.1| laccase, putative [Ricinus communis] gi|223547926|gb|EEF49418.1| laccase, putative [Ricinus communis] Length = 558 Score = 72.8 bits (177), Expect = 3e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 278 PGVWFMHCHLELHTGWGLKMAFVVEDGTGPNQSV 177 PGVWFMHCHLELHTGWGLK AFVVEDG+GP+ SV Sbjct: 515 PGVWFMHCHLELHTGWGLKTAFVVEDGSGPDLSV 548 >gb|ACN39933.1| unknown [Picea sitchensis] Length = 559 Score = 72.4 bits (176), Expect = 4e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 278 PGVWFMHCHLELHTGWGLKMAFVVEDGTGPNQSV 177 PGVWFMHCHLE+HT WGLKMAFVVE+G GPNQS+ Sbjct: 516 PGVWFMHCHLEVHTTWGLKMAFVVENGDGPNQSI 549