BLASTX nr result
ID: Coptis21_contig00035261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035261 (652 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513439.1| beta-glucosidase, putative [Ricinus communis... 177 2e-42 ref|XP_004154675.1| PREDICTED: beta-glucosidase 12-like [Cucumis... 175 8e-42 ref|XP_004151231.1| PREDICTED: beta-glucosidase 12-like, partial... 175 8e-42 ref|XP_002277198.1| PREDICTED: beta-glucosidase 12-like isoform ... 172 5e-41 gb|AEB61486.1| beta-glucosidase [Consolida orientalis] 172 6e-41 >ref|XP_002513439.1| beta-glucosidase, putative [Ricinus communis] gi|223547347|gb|EEF48842.1| beta-glucosidase, putative [Ricinus communis] Length = 500 Score = 177 bits (449), Expect = 2e-42 Identities = 87/125 (69%), Positives = 99/125 (79%), Gaps = 4/125 (3%) Frame = -1 Query: 487 QVASSWLSIYPRGIRDLLLYTTRKYRNPTIYITEKGVDEVNNTTLSLEEALMDNMRIDYY 308 + AS WL +YPRG RD+LLYT +KY NP IYITE G+DE NN TL L+E L+DNMRIDYY Sbjct: 374 KAASDWLYVYPRGFRDVLLYTKKKYNNPLIYITENGIDEFNNATLPLKEQLVDNMRIDYY 433 Query: 307 SIHLKFLLGAIND---VRGYFAWSLLDNFE*ASGYTVRFGINYVDYQT-LKRYPKHSSIW 140 HL FL AI D V+GYFAWSLLDNFE +SGYTVRFGINYVDY+ +KRYPK S+ W Sbjct: 434 YRHLSFLKRAIEDGANVKGYFAWSLLDNFEWSSGYTVRFGINYVDYKNGMKRYPKLSARW 493 Query: 139 FKKFL 125 FKKFL Sbjct: 494 FKKFL 498 >ref|XP_004154675.1| PREDICTED: beta-glucosidase 12-like [Cucumis sativus] Length = 507 Score = 175 bits (443), Expect = 8e-42 Identities = 86/127 (67%), Positives = 99/127 (77%), Gaps = 4/127 (3%) Frame = -1 Query: 487 QVASSWLSIYPRGIRDLLLYTTRKYRNPTIYITEKGVDEVNNTTLSLEEALMDNMRIDYY 308 + AS WL++YPRGIRD+LLY KY +P IYITE GVDE NN +L L+EAL+DN RIDYY Sbjct: 381 KAASPWLAVYPRGIRDVLLYIKGKYNDPLIYITENGVDEFNNASLPLKEALVDNFRIDYY 440 Query: 307 SIHLKFLLGAIND---VRGYFAWSLLDNFE*ASGYTVRFGINYVDYQT-LKRYPKHSSIW 140 HL FL AI D V+GYFAWSLLDNFE +SGYTVRFGIN+VDY+ KRYPK S+ W Sbjct: 441 KAHLSFLKKAIEDGVRVKGYFAWSLLDNFEWSSGYTVRFGINFVDYKDGFKRYPKSSAHW 500 Query: 139 FKKFLHH 119 FKKFL H Sbjct: 501 FKKFLKH 507 >ref|XP_004151231.1| PREDICTED: beta-glucosidase 12-like, partial [Cucumis sativus] Length = 433 Score = 175 bits (443), Expect = 8e-42 Identities = 86/127 (67%), Positives = 99/127 (77%), Gaps = 4/127 (3%) Frame = -1 Query: 487 QVASSWLSIYPRGIRDLLLYTTRKYRNPTIYITEKGVDEVNNTTLSLEEALMDNMRIDYY 308 + AS WL++YPRGIRD+LLY KY +P IYITE GVDE NN +L L+EAL+DN RIDYY Sbjct: 307 KAASPWLAVYPRGIRDVLLYIKGKYNDPLIYITENGVDEFNNASLPLKEALVDNFRIDYY 366 Query: 307 SIHLKFLLGAIND---VRGYFAWSLLDNFE*ASGYTVRFGINYVDYQT-LKRYPKHSSIW 140 HL FL AI D V+GYFAWSLLDNFE +SGYTVRFGIN+VDY+ KRYPK S+ W Sbjct: 367 KAHLSFLKKAIEDGVRVKGYFAWSLLDNFEWSSGYTVRFGINFVDYKDGFKRYPKSSAHW 426 Query: 139 FKKFLHH 119 FKKFL H Sbjct: 427 FKKFLKH 433 >ref|XP_002277198.1| PREDICTED: beta-glucosidase 12-like isoform 1 [Vitis vinifera] Length = 505 Score = 172 bits (436), Expect = 5e-41 Identities = 87/122 (71%), Positives = 97/122 (79%), Gaps = 4/122 (3%) Frame = -1 Query: 478 SSWLSIYPRGIRDLLLYTTRKYRNPTIYITEKGVDEVNNTTLSLEEALMDNMRIDYYSIH 299 SSWLS+YP GIR LLLY RKY NP IYITE GV EVNN TL+L+EAL D+ RIDYY H Sbjct: 383 SSWLSVYPSGIRSLLLYVKRKYNNPLIYITENGVSEVNNNTLTLKEALKDSKRIDYYYRH 442 Query: 298 LKFLLGAIND---VRGYFAWSLLDNFE*ASGYTVRFGINYVDYQT-LKRYPKHSSIWFKK 131 L FL AI D V+GYFAWSLLDN+E + GYTVRFGI +VDY+ LKRYPKHS+IWFKK Sbjct: 443 LLFLQLAIKDGVNVKGYFAWSLLDNYEWSFGYTVRFGIFFVDYENGLKRYPKHSAIWFKK 502 Query: 130 FL 125 FL Sbjct: 503 FL 504 >gb|AEB61486.1| beta-glucosidase [Consolida orientalis] Length = 508 Score = 172 bits (435), Expect = 6e-41 Identities = 82/124 (66%), Positives = 96/124 (77%), Gaps = 3/124 (2%) Frame = -1 Query: 487 QVASSWLSIYPRGIRDLLLYTTRKYRNPTIYITEKGVDEVNNTTLSLEEALMDNMRIDYY 308 + A SWL +YP GI +LL YT KY NP IYITE G+ E NN+TLSLEEAL D MRIDY+ Sbjct: 383 KTALSWLRVYPIGILNLLKYTKEKYDNPIIYITENGIAEANNSTLSLEEALTDPMRIDYH 442 Query: 307 SIHLKFLLGAIND---VRGYFAWSLLDNFE*ASGYTVRFGINYVDYQTLKRYPKHSSIWF 137 HL F L AI + ++GYFAWS LDNFE GYTVRFG+NYVD++T+KRYPKH+SIWF Sbjct: 443 RRHLSFALRAIKEGVNIKGYFAWSFLDNFEWVDGYTVRFGLNYVDFKTMKRYPKHASIWF 502 Query: 136 KKFL 125 KKFL Sbjct: 503 KKFL 506