BLASTX nr result
ID: Coptis21_contig00035096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035096 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO53105.1| epsilon carotene hydroxylase [Actinidia chinensis] 172 3e-41 dbj|BAD94136.1| Cytochrom P450 -like protein [Arabidopsis thaliana] 169 2e-40 ref|NP_190881.2| carotenoid epsilon-ring hydroxylase [Arabidopsi... 169 2e-40 gb|AAM13903.1| putative cytochrome P450 [Arabidopsis thaliana] 169 2e-40 emb|CAB64216.1| Cytochrom P450-like protein [Arabidopsis thaliana] 169 2e-40 >gb|ACO53105.1| epsilon carotene hydroxylase [Actinidia chinensis] Length = 208 Score = 172 bits (435), Expect = 3e-41 Identities = 80/90 (88%), Positives = 86/90 (95%) Frame = -3 Query: 272 QEEVDRVLQGRLPTYEDIKQLKYLTRCINESMRLYPHPPVLIRRAQAPDMLPGNYKVNSG 93 QEEVDRVLQGR PTYEDIK LK+LTRCINES+RLYPHPPVL+RRAQ PD+LPGNYKVN+G Sbjct: 31 QEEVDRVLQGRPPTYEDIKNLKFLTRCINESLRLYPHPPVLLRRAQVPDVLPGNYKVNAG 90 Query: 92 QDIMISVYNIHRSSQVWERAEEFVPERFDL 3 QDIMISVYNIH S+QVWERAEEFVPERFDL Sbjct: 91 QDIMISVYNIHHSAQVWERAEEFVPERFDL 120 >dbj|BAD94136.1| Cytochrom P450 -like protein [Arabidopsis thaliana] Length = 301 Score = 169 bits (429), Expect = 2e-40 Identities = 77/90 (85%), Positives = 87/90 (96%) Frame = -3 Query: 272 QEEVDRVLQGRLPTYEDIKQLKYLTRCINESMRLYPHPPVLIRRAQAPDMLPGNYKVNSG 93 QEEVDRVL+GR P +EDIK+LKY+TRCINESMRLYPHPPVLIRRAQ PD+LPGNYKVN+G Sbjct: 136 QEEVDRVLEGRNPAFEDIKELKYITRCINESMRLYPHPPVLIRRAQVPDILPGNYKVNTG 195 Query: 92 QDIMISVYNIHRSSQVWERAEEFVPERFDL 3 QDIMISVYNIHRSS+VWE+AEEF+PERFD+ Sbjct: 196 QDIMISVYNIHRSSEVWEKAEEFLPERFDI 225 >ref|NP_190881.2| carotenoid epsilon-ring hydroxylase [Arabidopsis thaliana] gi|75292264|sp|Q6TBX7.1|LUT1_ARATH RecName: Full=Carotene epsilon-monooxygenase, chloroplastic; AltName: Full=Cytochrome P450 97C1; AltName: Full=Protein LUTEIN DEFICIENT 1; Flags: Precursor gi|40218379|gb|AAR83120.1| chloroplast carotenoid epsilon-ring hydroxylase [Arabidopsis thaliana] gi|332645519|gb|AEE79040.1| carotenoid epsilon-ring hydroxylase [Arabidopsis thaliana] Length = 539 Score = 169 bits (429), Expect = 2e-40 Identities = 77/90 (85%), Positives = 87/90 (96%) Frame = -3 Query: 272 QEEVDRVLQGRLPTYEDIKQLKYLTRCINESMRLYPHPPVLIRRAQAPDMLPGNYKVNSG 93 QEEVDRVL+GR P +EDIK+LKY+TRCINESMRLYPHPPVLIRRAQ PD+LPGNYKVN+G Sbjct: 374 QEEVDRVLEGRNPAFEDIKELKYITRCINESMRLYPHPPVLIRRAQVPDILPGNYKVNTG 433 Query: 92 QDIMISVYNIHRSSQVWERAEEFVPERFDL 3 QDIMISVYNIHRSS+VWE+AEEF+PERFD+ Sbjct: 434 QDIMISVYNIHRSSEVWEKAEEFLPERFDI 463 >gb|AAM13903.1| putative cytochrome P450 [Arabidopsis thaliana] Length = 552 Score = 169 bits (429), Expect = 2e-40 Identities = 77/90 (85%), Positives = 87/90 (96%) Frame = -3 Query: 272 QEEVDRVLQGRLPTYEDIKQLKYLTRCINESMRLYPHPPVLIRRAQAPDMLPGNYKVNSG 93 QEEVDRVL+GR P +EDIK+LKY+TRCINESMRLYPHPPVLIRRAQ PD+LPGNYKVN+G Sbjct: 387 QEEVDRVLEGRNPAFEDIKELKYITRCINESMRLYPHPPVLIRRAQVPDILPGNYKVNTG 446 Query: 92 QDIMISVYNIHRSSQVWERAEEFVPERFDL 3 QDIMISVYNIHRSS+VWE+AEEF+PERFD+ Sbjct: 447 QDIMISVYNIHRSSEVWEKAEEFLPERFDI 476 >emb|CAB64216.1| Cytochrom P450-like protein [Arabidopsis thaliana] Length = 566 Score = 169 bits (429), Expect = 2e-40 Identities = 77/90 (85%), Positives = 87/90 (96%) Frame = -3 Query: 272 QEEVDRVLQGRLPTYEDIKQLKYLTRCINESMRLYPHPPVLIRRAQAPDMLPGNYKVNSG 93 QEEVDRVL+GR P +EDIK+LKY+TRCINESMRLYPHPPVLIRRAQ PD+LPGNYKVN+G Sbjct: 401 QEEVDRVLEGRNPAFEDIKELKYITRCINESMRLYPHPPVLIRRAQVPDILPGNYKVNTG 460 Query: 92 QDIMISVYNIHRSSQVWERAEEFVPERFDL 3 QDIMISVYNIHRSS+VWE+AEEF+PERFD+ Sbjct: 461 QDIMISVYNIHRSSEVWEKAEEFLPERFDI 490