BLASTX nr result
ID: Coptis21_contig00034999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034999 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543447.1| PREDICTED: uncharacterized protein LOC100796... 55 8e-06 >ref|XP_003543447.1| PREDICTED: uncharacterized protein LOC100796237 [Glycine max] Length = 283 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/72 (38%), Positives = 43/72 (59%) Frame = +1 Query: 1 GASINNPGPSGAGCILRDAMGKFIMGAAIPIFKSTNNIAEALAILYGIMLLRNLEFRKVI 180 GAS NPGP+GAG IL D + + + I TNN+AE +++ G+ ++ +I Sbjct: 151 GASKGNPGPAGAGAILHDGSKVYRLREGVGI--QTNNVAEYRSLILGLKHALKKGYKHII 208 Query: 181 VETDSLMLCNAI 216 V+ DSL++CN I Sbjct: 209 VQGDSLLVCNQI 220