BLASTX nr result
ID: Coptis21_contig00034930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034930 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ48943.1| clp protease proteolytic subunit, partial [Trades... 57 2e-06 gb|ADM92652.1| clp protease proteolytic subunit protein [Davidia... 55 8e-06 gb|ADD31110.1| clp protease proteolytic subunit protein [Ximenia... 55 8e-06 gb|ADD31101.1| clp protease proteolytic subunit protein [Aucuba ... 55 8e-06 gb|AEX96572.1| clp protease proteolytic subunit (chloroplast) [C... 54 1e-05 >gb|AEZ48943.1| clp protease proteolytic subunit, partial [Tradescantia ohiensis] Length = 201 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 277 YIIRVMIHQPASSYYEAQTGEFVLEAEEL 363 YIIRVMIHQPASS+YEAQ GEF+LEAEEL Sbjct: 124 YIIRVMIHQPASSFYEAQAGEFILEAEEL 152 >gb|ADM92652.1| clp protease proteolytic subunit protein [Davidia involucrata] Length = 195 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 286 RVMIHQPASSYYEAQTGEFVLEAEEL 363 RVMIHQPASSYYEAQTGEF+LEAEEL Sbjct: 121 RVMIHQPASSYYEAQTGEFILEAEEL 146 >gb|ADD31110.1| clp protease proteolytic subunit protein [Ximenia americana] Length = 198 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 283 IRVMIHQPASSYYEAQTGEFVLEAEEL 363 IRVMIHQPASSY+EAQTGEF+LEAEEL Sbjct: 123 IRVMIHQPASSYFEAQTGEFILEAEEL 149 >gb|ADD31101.1| clp protease proteolytic subunit protein [Aucuba japonica] Length = 198 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 283 IRVMIHQPASSYYEAQTGEFVLEAEEL 363 IRVMIHQPASS+YEAQTGEF+LEAEEL Sbjct: 123 IRVMIHQPASSFYEAQTGEFILEAEEL 149 >gb|AEX96572.1| clp protease proteolytic subunit (chloroplast) [Calibanus hookerii] Length = 210 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +1 Query: 265 HSLCY-IIRVMIHQPASSYYEAQTGEFVLEAEEL 363 H++ Y IRVMIHQPASS+YEAQ GEF+LEAEEL Sbjct: 120 HAMLYQYIRVMIHQPASSFYEAQAGEFILEAEEL 153