BLASTX nr result
ID: Coptis21_contig00034918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034918 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264026.1| PREDICTED: nudix hydrolase 16, mitochondrial... 94 1e-17 emb|CAN73175.1| hypothetical protein VITISV_007719 [Vitis vinifera] 94 1e-17 ref|XP_002882782.1| hypothetical protein ARALYDRAFT_478618 [Arab... 89 5e-16 ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial... 85 7e-15 ref|NP_566428.1| nudix hydrolase 16 [Arabidopsis thaliana] gi|68... 83 2e-14 >ref|XP_002264026.1| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera] gi|296087852|emb|CBI35108.3| unnamed protein product [Vitis vinifera] Length = 180 Score = 94.0 bits (232), Expect = 1e-17 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +2 Query: 2 KEELNSWPEQNTRQRRWLTVPEAAENCRHAWMREVLEEGFCKWHEEKLSAGK 157 KEEL SWPEQNTR+R WLT+PEA ENCRH WMRE L++GF KWHE K+S G+ Sbjct: 123 KEELESWPEQNTRRRSWLTIPEAYENCRHPWMREALKDGFSKWHENKISTGE 174 >emb|CAN73175.1| hypothetical protein VITISV_007719 [Vitis vinifera] Length = 395 Score = 94.0 bits (232), Expect = 1e-17 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +2 Query: 2 KEELNSWPEQNTRQRRWLTVPEAAENCRHAWMREVLEEGFCKWHEEKLSAGK 157 KEEL SWPEQNTR+R WLT+PEA ENCRH WMRE L++GF KWHE K+S G+ Sbjct: 338 KEELESWPEQNTRRRSWLTIPEAYENCRHPWMREALKDGFSKWHENKISTGE 389 >ref|XP_002882782.1| hypothetical protein ARALYDRAFT_478618 [Arabidopsis lyrata subsp. lyrata] gi|297328622|gb|EFH59041.1| hypothetical protein ARALYDRAFT_478618 [Arabidopsis lyrata subsp. lyrata] Length = 180 Score = 88.6 bits (218), Expect = 5e-16 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = +2 Query: 2 KEELNSWPEQNTRQRRWLTVPEAAENCRHAWMREVLEEGFCKWHEEKLSAGK 157 KEEL +WPE TR R+WLT+ EA ENCRHAWM++ L EGFCKWH+EK+ G+ Sbjct: 123 KEELETWPEHETRTRKWLTIEEAVENCRHAWMKDALVEGFCKWHKEKMDKGE 174 >ref|XP_002272200.1| PREDICTED: nudix hydrolase 16, mitochondrial [Vitis vinifera] gi|147852980|emb|CAN81261.1| hypothetical protein VITISV_019710 [Vitis vinifera] gi|297739943|emb|CBI30125.3| unnamed protein product [Vitis vinifera] Length = 182 Score = 84.7 bits (208), Expect = 7e-15 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +2 Query: 2 KEELNSWPEQNTRQRRWLTVPEAAENCRHAWMREVLEEGFCKWHEEKL 145 KEEL SWPEQ+TR+R WLT+PEA E CRH WMR+ LEEGF KWH++ L Sbjct: 123 KEELPSWPEQSTRERSWLTIPEAIERCRHPWMRKALEEGFSKWHDDHL 170 >ref|NP_566428.1| nudix hydrolase 16 [Arabidopsis thaliana] gi|68565942|sp|Q9LHK1.1|NUD16_ARATH RecName: Full=Nudix hydrolase 16, mitochondrial; Short=AtNUDT16; Flags: Precursor gi|11762150|gb|AAG40353.1|AF325001_1 AT3g12600 [Arabidopsis thaliana] gi|12321963|gb|AAG51020.1|AC069474_19 unknown protein; 22985-21799 [Arabidopsis thaliana] gi|13926332|gb|AAK49630.1|AF372914_1 AT3g12600/T2E22_108 [Arabidopsis thaliana] gi|9294354|dbj|BAB02251.1| unnamed protein product [Arabidopsis thaliana] gi|27363312|gb|AAO11575.1| At3g12600/T2E22_108 [Arabidopsis thaliana] gi|332641700|gb|AEE75221.1| nudix hydrolase 16 [Arabidopsis thaliana] Length = 180 Score = 83.2 bits (204), Expect = 2e-14 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +2 Query: 2 KEELNSWPEQNTRQRRWLTVPEAAENCRHAWMREVLEEGFCKWHEEKLSAGK 157 KEEL +WPE TR R+WLT+ EA E+CRH WM++ L EGFCKWH+EK+ G+ Sbjct: 123 KEELATWPEHETRTRKWLTIEEAVESCRHPWMKDALVEGFCKWHKEKMVKGE 174