BLASTX nr result
ID: Coptis21_contig00034910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034910 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274352.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002274352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 536 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = +1 Query: 13 VVKTLGCSSIEVNDLVHKFVAGEETQQQMEEIDEVLERMKGQLDA*GVEGFD 168 V K GCSS+++N +VH+F+AGEET QMEE+ VLE+M Q+ G GF+ Sbjct: 474 VDKAPGCSSVKINGVVHEFIAGEETHLQMEEVHRVLEKMNKQM---GYSGFN 522