BLASTX nr result
ID: Coptis21_contig00034658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034658 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317040.1| NAC domain protein, IPR003441 [Populus trich... 57 2e-06 ref|XP_004173168.1| PREDICTED: NAC domain-containing protein 78-... 56 3e-06 gb|ADQ00628.1| NAC-like protein 1 [Phytolacca acinosa] 55 5e-06 ref|XP_002321956.1| NAC domain protein, IPR003441 [Populus trich... 55 5e-06 gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrh... 55 6e-06 >ref|XP_002317040.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222860105|gb|EEE97652.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 429 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 4/44 (9%) Frame = -3 Query: 315 KKSSTNA----FKSIMVFYTGQAPNGARTNWVMHEYKITQKDLD 196 +KS+ N K +VFY G+APNG RTNWVMHEY+ T+KDLD Sbjct: 101 RKSAGNTTLIGMKKTLVFYRGRAPNGKRTNWVMHEYRPTEKDLD 144 >ref|XP_004173168.1| PREDICTED: NAC domain-containing protein 78-like [Cucumis sativus] Length = 566 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/53 (43%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -3 Query: 303 TNAFKSIMVFYTGQAPNGARTNWVMHEYKITQKDLDEKK-RLTVPEGKAAICR 148 T K +V++ G+AP GARTNWVMHEYK+T +++DE+ ++ + + +CR Sbjct: 107 TVGMKKTLVYHIGRAPRGARTNWVMHEYKLTDEEMDEEMGKIGIVQDAFVLCR 159 >gb|ADQ00628.1| NAC-like protein 1 [Phytolacca acinosa] Length = 297 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/70 (37%), Positives = 37/70 (52%) Frame = -3 Query: 318 IKKSSTNAFKSIMVFYTGQAPNGARTNWVMHEYKITQKDLDEKKRLTVPEGKAAICRNMG 139 I K T A K +VFY G+AP G +TNW+MHEY+ D KR + +CR Sbjct: 104 IGKPKTLAIKKALVFYAGKAPKGVKTNWIMHEYRPANVDRSAGKRTNLRLDDWVLCRIYN 163 Query: 138 AEKEIDKSWF 109 + I+K ++ Sbjct: 164 KKGIIEKGYY 173 >ref|XP_002321956.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222868952|gb|EEF06083.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 381 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/44 (56%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = -3 Query: 312 KSSTN--AFKSIMVFYTGQAPNGARTNWVMHEYKITQKDLDEKK 187 KS N K +VFYTG+AP G RTNWVMHEY+ T+++LD K Sbjct: 104 KSGNNLIGMKKTLVFYTGRAPKGKRTNWVMHEYRATEEELDGTK 147 >gb|AEQ61905.1| NAC domain-containing protein 1 [Salvia miltiorrhiza] Length = 292 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/69 (33%), Positives = 37/69 (53%) Frame = -3 Query: 318 IKKSSTNAFKSIMVFYTGQAPNGARTNWVMHEYKITQKDLDEKKRLTVPEGKAAICRNMG 139 + K T K +VFY G+AP G +TNW+MHEY++ D KR + +CR Sbjct: 100 VGKPKTLGIKKALVFYAGKAPKGVKTNWIMHEYRLANVDRSAGKRSNLRLDDWVLCRIYN 159 Query: 138 AEKEIDKSW 112 ++ ++K + Sbjct: 160 KKRTLEKHY 168