BLASTX nr result
ID: Coptis21_contig00034647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034647 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621690.1| Cytochrome c biogenesis protein ccsA [Medica... 55 8e-06 >ref|XP_003621690.1| Cytochrome c biogenesis protein ccsA [Medicago truncatula] gi|355496705|gb|AES77908.1| Cytochrome c biogenesis protein ccsA [Medicago truncatula] Length = 666 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/65 (36%), Positives = 36/65 (55%) Frame = +1 Query: 1 VWNKYVLPRHAFTTWQLFANYLPKEDKLIKKTVLQTF*CCLSNNANSTENSLHLFFDCPY 180 +WN Y+ P +F TW+L N LP ++ L K+ L CC S E+S H+FF+C Sbjct: 40 LWNSYIPPSRSFITWRLLHNKLPTDENLRKRGCLIVSICCFC--MKSAESSQHIFFECHV 97 Query: 181 SPPIW 195 + +W Sbjct: 98 TSRLW 102