BLASTX nr result
ID: Coptis21_contig00033859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033859 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAO89150.1| NBS-type resistance protein [Gossypium barbadense] 56 3e-06 >gb|AAO89150.1| NBS-type resistance protein [Gossypium barbadense] Length = 166 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = +2 Query: 197 MMNIHNRIAKEKTFDKIIWVNLSKHWSLEKVQNDIAVQLNVELPKERFNVIR 352 M +IHN + KE+ F++++WV +SK +++ K+QNDIA LN ++PKE V R Sbjct: 8 MKHIHNDLLKEQRFERVVWVTISKEFNIVKLQNDIASALNGKIPKEANKVRR 59