BLASTX nr result
ID: Coptis21_contig00033822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033822 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43553.1|AF211535_1 Avr9/Cf-9 rapidly elicited protein 194 ... 66 3e-09 ref|XP_002299484.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002509936.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >gb|AAG43553.1|AF211535_1 Avr9/Cf-9 rapidly elicited protein 194 [Nicotiana tabacum] Length = 155 Score = 65.9 bits (159), Expect = 3e-09 Identities = 34/54 (62%), Positives = 39/54 (72%) Frame = +3 Query: 3 GVYFVYDRSGALSTIPEASEHGMECMGHSTEFDSIVRKTASERFTAASIGISCA 164 G Y +YD+SGAL+TIPE G EC S E S+VR+T SERFT ASIGISCA Sbjct: 106 GFYVIYDKSGALTTIPE----GPECDNLSPEIKSLVRRTGSERFTVASIGISCA 155 >ref|XP_002299484.1| predicted protein [Populus trichocarpa] gi|222846742|gb|EEE84289.1| predicted protein [Populus trichocarpa] Length = 142 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = +3 Query: 9 YFVYDRSGALSTIPEASEHGMECMGHSTEFDSIVRKTASERFTAASIGIS 158 Y +YD+SGAL+TIPE E ++ G S E +S+VRKT S+RFTAASIGIS Sbjct: 95 YVIYDKSGALTTIPEVPE--IDFGGFSPEINSLVRKTVSDRFTAASIGIS 142 >ref|XP_002509936.1| conserved hypothetical protein [Ricinus communis] gi|223549835|gb|EEF51323.1| conserved hypothetical protein [Ricinus communis] Length = 182 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/51 (60%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = +3 Query: 15 VYDRSGALSTIPEASEHGMECMGHSTEFDSIVRKTASERFTAASI-GISCA 164 VYD+SGALSTIPE E ++ G S E +S+VR++ SERFTA S+ GISCA Sbjct: 134 VYDKSGALSTIPEVPE--IDFGGFSPEINSLVRRSGSERFTATSVMGISCA 182