BLASTX nr result
ID: Coptis21_contig00033768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033768 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518586.1| pentatricopeptide repeat-containing protein,... 56 3e-06 >ref|XP_002518586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542431|gb|EEF43973.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 377 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/69 (49%), Positives = 42/69 (60%) Frame = +1 Query: 79 STPLANPTPQTRKSLMKDLLKEKNLTTLVENFKAFSELP*FRSDRKFYDVIVHRLAIAKE 258 ST L T R S +K L KE+NL LVE FK FSE FR+ Y+ + RLAIAK Sbjct: 15 STQLTTGTA-ARASSVKVLYKERNLKRLVEKFKKFSENDRFRTKTGIYEETIRRLAIAKR 73 Query: 259 FSKIEQVLE 285 F+ IE++LE Sbjct: 74 FNWIEEILE 82