BLASTX nr result
ID: Coptis21_contig00032793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032793 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150531.1| PREDICTED: N-alpha-acetyltransferase 35, Nat... 59 4e-07 >ref|XP_004150531.1| PREDICTED: N-alpha-acetyltransferase 35, NatC auxiliary subunit-like [Cucumis sativus] gi|449518131|ref|XP_004166097.1| PREDICTED: N-alpha-acetyltransferase 35, NatC auxiliary subunit-like [Cucumis sativus] Length = 726 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -2 Query: 97 SPLSSGDQTVWADVSPLLQSACQDLEDGEMIH 2 SP+ SG+ TVWADVSPLL++ACQDL+DGE+IH Sbjct: 20 SPIPSGEHTVWADVSPLLEAACQDLQDGELIH 51