BLASTX nr result
ID: Coptis21_contig00032705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032705 (622 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273630.1| PREDICTED: RING-H2 finger protein ATL57-like... 59 7e-07 ref|XP_002523741.1| zinc finger protein, putative [Ricinus commu... 56 6e-06 >ref|XP_002273630.1| PREDICTED: RING-H2 finger protein ATL57-like [Vitis vinifera] Length = 244 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 448 FDTSMALTVLVILTALFFMGFFSVYLRRYGGDSPIE 555 FD+SMALTV+V+LTALFFMGFFSVY+RR+ D+ +E Sbjct: 52 FDSSMALTVIVLLTALFFMGFFSVYIRRFAEDNAVE 87 >ref|XP_002523741.1| zinc finger protein, putative [Ricinus communis] gi|223537045|gb|EEF38681.1| zinc finger protein, putative [Ricinus communis] Length = 254 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 448 FDTSMALTVLVILTALFFMGFFSVYLRRYGGDSPIEF 558 FD+SMALTVLV+L+ALFFMGFFS+Y+RR+ + EF Sbjct: 46 FDSSMALTVLVLLSALFFMGFFSIYIRRFSTEPASEF 82