BLASTX nr result
ID: Coptis21_contig00032699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032699 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC61290.1| putative retroelement pol polyprotein [Arabidopsi... 49 2e-06 dbj|BAD34493.1| Gag-Pol [Ipomoea batatas] 41 1e-05 >gb|AAC61290.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1149 Score = 49.3 bits (116), Expect(2) = 2e-06 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = +3 Query: 3 SINGFSYYASIVDDHSRYCWIFPLCNKSDFC 95 SI GF YY +D+ SR+CW +PL +KSDFC Sbjct: 519 SIQGFQYYVIFIDNRSRFCWFYPLKHKSDFC 549 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 94 AVFQSFKSLVENLLTGKIQCVRTDNG 171 ++F F+S VENLL KI ++D G Sbjct: 550 SLFMKFQSFVENLLQTKIGTFQSDGG 575 >dbj|BAD34493.1| Gag-Pol [Ipomoea batatas] Length = 1298 Score = 41.2 bits (95), Expect(2) = 1e-05 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = +3 Query: 3 SINGFSYYASIVDDHSRYCWIFPLCNKSD 89 S+ G Y+ S +DD+SR CW++P+ KSD Sbjct: 486 SLGGAKYFVSFIDDYSRRCWVYPIKKKSD 514 Score = 32.7 bits (73), Expect(2) = 1e-05 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 88 IFAVFQSFKSLVENLLTGKIQCVRTDNG 171 +FA F++FK+ VE KI+C RTDNG Sbjct: 515 VFATFKAFKARVELDSGKKIKCFRTDNG 542