BLASTX nr result
ID: Coptis21_contig00032662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032662 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269066.2| PREDICTED: pentatricopeptide repeat-containi... 100 9e-20 emb|CBI17752.3| unnamed protein product [Vitis vinifera] 100 9e-20 ref|XP_002513116.1| pentatricopeptide repeat-containing protein,... 92 6e-17 ref|XP_003555182.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_003598903.1| Pentatricopeptide repeat-containing protein ... 89 5e-16 >ref|XP_002269066.2| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Vitis vinifera] Length = 1294 Score = 100 bits (250), Expect = 9e-20 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = -3 Query: 358 RKVFTSMRERKLLTEANLIIYEEQLIDHMKKKTAGLVLSGLKFFGLESKLKSKGSTILP 182 RKVF++MRERKLLTEAN+I+Y+E LI+HMKKKTA LVLSGLKFFGLESKL+SKGST+LP Sbjct: 1166 RKVFSNMRERKLLTEANVIVYDEILIEHMKKKTADLVLSGLKFFGLESKLRSKGSTLLP 1224 >emb|CBI17752.3| unnamed protein product [Vitis vinifera] Length = 729 Score = 100 bits (250), Expect = 9e-20 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = -3 Query: 358 RKVFTSMRERKLLTEANLIIYEEQLIDHMKKKTAGLVLSGLKFFGLESKLKSKGSTILP 182 RKVF++MRERKLLTEAN+I+Y+E LI+HMKKKTA LVLSGLKFFGLESKL+SKGST+LP Sbjct: 662 RKVFSNMRERKLLTEANVIVYDEILIEHMKKKTADLVLSGLKFFGLESKLRSKGSTLLP 720 >ref|XP_002513116.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548127|gb|EEF49619.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1128 Score = 91.7 bits (226), Expect = 6e-17 Identities = 44/58 (75%), Positives = 53/58 (91%) Frame = -3 Query: 358 RKVFTSMRERKLLTEANLIIYEEQLIDHMKKKTAGLVLSGLKFFGLESKLKSKGSTIL 185 RKVFT++RERKLLTEA I Y+E+LI+HMKKKTA LV+SGLKFFGLESKL++KG T+L Sbjct: 1069 RKVFTNLRERKLLTEAKTIFYDERLIEHMKKKTADLVVSGLKFFGLESKLRAKGCTLL 1126 >ref|XP_003555182.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Glycine max] Length = 733 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/59 (72%), Positives = 51/59 (86%) Frame = -3 Query: 358 RKVFTSMRERKLLTEANLIIYEEQLIDHMKKKTAGLVLSGLKFFGLESKLKSKGSTILP 182 RKVF+++RER LTE+N I+Y+E LIDHMKKKTA LVLS LKFFGLESKLK+KG +LP Sbjct: 674 RKVFSNLRERNFLTESNTIVYDELLIDHMKKKTADLVLSSLKFFGLESKLKAKGCKLLP 732 >ref|XP_003598903.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355487951|gb|AES69154.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 767 Score = 88.6 bits (218), Expect = 5e-16 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -3 Query: 358 RKVFTSMRERKLLTEANLIIYEEQLIDHMKKKTAGLVLSGLKFFGLESKLKSKG 197 RKVF+ +RERKLLTE++ I+Y+E LIDHMKKKTA LV+SGLKFFGLESKLKSKG Sbjct: 664 RKVFSILRERKLLTESDTIVYDELLIDHMKKKTADLVISGLKFFGLESKLKSKG 717