BLASTX nr result
ID: Coptis21_contig00032625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032625 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526574.1| Rho GDP-dissociation inhibitor, putative [Ri... 69 3e-10 gb|ABK96079.1| unknown [Populus trichocarpa] 69 3e-10 emb|CBI37157.3| unnamed protein product [Vitis vinifera] 67 1e-09 ref|XP_002271565.1| PREDICTED: rho GDP-dissociation inhibitor 1 ... 67 1e-09 ref|XP_004164926.1| PREDICTED: rho GDP-dissociation inhibitor 1-... 67 2e-09 >ref|XP_002526574.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] gi|223534135|gb|EEF35852.1| Rho GDP-dissociation inhibitor, putative [Ricinus communis] Length = 244 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 207 TTPSGVLVRGFYSAKFKFEDDDQRCHLELNYSFEIKK 97 TTPSGVL RG YSAK KFEDDD+RCH+EL YSFEIKK Sbjct: 206 TTPSGVLARGTYSAKLKFEDDDRRCHMELKYSFEIKK 242 >gb|ABK96079.1| unknown [Populus trichocarpa] Length = 235 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 207 TTPSGVLVRGFYSAKFKFEDDDQRCHLELNYSFEIKK 97 TTPSGVL RG YSAK KFEDDD+RCH+EL YSFEIKK Sbjct: 197 TTPSGVLARGTYSAKLKFEDDDRRCHMELKYSFEIKK 233 >emb|CBI37157.3| unnamed protein product [Vitis vinifera] Length = 203 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 207 TTPSGVLVRGFYSAKFKFEDDDQRCHLELNYSFEIKK 97 TTPSGVL RG YSAK KF+DDD+RCH+EL YSF+IKK Sbjct: 165 TTPSGVLARGTYSAKLKFQDDDRRCHMELKYSFQIKK 201 >ref|XP_002271565.1| PREDICTED: rho GDP-dissociation inhibitor 1 [Vitis vinifera] Length = 237 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 207 TTPSGVLVRGFYSAKFKFEDDDQRCHLELNYSFEIKK 97 TTPSGVL RG YSAK KF+DDD+RCH+EL YSF+IKK Sbjct: 199 TTPSGVLARGTYSAKLKFQDDDRRCHMELKYSFQIKK 235 >ref|XP_004164926.1| PREDICTED: rho GDP-dissociation inhibitor 1-like [Cucumis sativus] Length = 214 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 207 TTPSGVLVRGFYSAKFKFEDDDQRCHLELNYSFEIKK 97 TTPSG+L RG YSAK KFEDDD+RC++EL YSFEIKK Sbjct: 176 TTPSGILARGIYSAKLKFEDDDKRCYMELPYSFEIKK 212