BLASTX nr result
ID: Coptis21_contig00032526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032526 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39605.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] 67 2e-09 ref|XP_004170418.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 ref|XP_004135765.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 >emb|CBI39605.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 293 TKLISHAYKREIIVRDRLRYHHFKNGKCSCSDFW 192 TKLIS Y REIIVRDR+RYHHF+NG CSC DFW Sbjct: 591 TKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 624 >ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 isoform 1 [Vitis vinifera] Length = 672 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 293 TKLISHAYKREIIVRDRLRYHHFKNGKCSCSDFW 192 TKLIS Y REIIVRDR+RYHHF+NG CSC DFW Sbjct: 639 TKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 672 >emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] Length = 673 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 293 TKLISHAYKREIIVRDRLRYHHFKNGKCSCSDFW 192 TKLIS Y REIIVRDR+RYHHF+NG CSC DFW Sbjct: 640 TKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 673 >ref|XP_004170418.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 666 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 293 TKLISHAYKREIIVRDRLRYHHFKNGKCSCSDFW 192 TKLIS + REIIVRDR+RYHHFKNG CSC DFW Sbjct: 633 TKLISQIFDREIIVRDRVRYHHFKNGTCSCKDFW 666 >ref|XP_004135765.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 666 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 293 TKLISHAYKREIIVRDRLRYHHFKNGKCSCSDFW 192 TKLIS + REIIVRDR+RYHHFKNG CSC DFW Sbjct: 633 TKLISQIFDREIIVRDRVRYHHFKNGTCSCKDFW 666