BLASTX nr result
ID: Coptis21_contig00031819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031819 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35940.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002275659.2| PREDICTED: 3-epi-6-deoxocathasterone 23-mono... 80 2e-13 ref|XP_002527414.1| cytochrome P450, putative [Ricinus communis]... 73 2e-11 ref|XP_003529897.1| PREDICTED: 3-epi-6-deoxocathasterone 23-mono... 73 3e-11 gb|ADN34104.1| cytochrome p450 [Cucumis melo subsp. melo] 72 6e-11 >emb|CBI35940.3| unnamed protein product [Vitis vinifera] Length = 475 Score = 83.6 bits (205), Expect = 2e-14 Identities = 41/70 (58%), Positives = 51/70 (72%) Frame = +1 Query: 55 WTFCMTGICISISIIVLYRSWSRIRSLKTGPLPLGTFGWPFVGETMAFISSAYSAHPESF 234 W +T I +S +II+LYR+ SRIRS + LPLGT GWP +GET+ FIS AYS PESF Sbjct: 5 WIVFLTAIFLS-TIILLYRNRSRIRSSPSSSLPLGTLGWPLIGETLEFISCAYSDRPESF 63 Query: 235 MDKRRLKYGK 264 M++RR YGK Sbjct: 64 MERRRRMYGK 73 >ref|XP_002275659.2| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Vitis vinifera] Length = 478 Score = 80.1 bits (196), Expect = 2e-13 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = +1 Query: 70 TGICISISIIVLYRSWSRIRSLKTGPLPLGTFGWPFVGETMAFISSAYSAHPESFMDKRR 249 T I +S +II+LYR+ SRIRS + LPLGT GWP +GET+ FIS AYS PESFM++RR Sbjct: 13 TAIFLS-TIILLYRNRSRIRSSPSSSLPLGTLGWPLIGETLEFISCAYSDRPESFMERRR 71 Query: 250 LKYGK 264 YGK Sbjct: 72 RMYGK 76 >ref|XP_002527414.1| cytochrome P450, putative [Ricinus communis] gi|223533224|gb|EEF34980.1| cytochrome P450, putative [Ricinus communis] Length = 482 Score = 73.2 bits (178), Expect = 2e-11 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 5/63 (7%) Frame = +1 Query: 91 SIIVLYRSWSRI----RSLKTG-PLPLGTFGWPFVGETMAFISSAYSAHPESFMDKRRLK 255 S+I+LYR+ RS KT PLPLG GWPF+GET+ F+S AYS PESFMDKRR Sbjct: 15 SVIILYRNCRLFSILFRSSKTKTPLPLGNLGWPFLGETLEFVSCAYSDRPESFMDKRRRM 74 Query: 256 YGK 264 YGK Sbjct: 75 YGK 77 >ref|XP_003529897.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like isoform 1 [Glycine max] Length = 473 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/75 (49%), Positives = 46/75 (61%) Frame = +1 Query: 40 MDNSSWTFCMTGICISISIIVLYRSWSRIRSLKTGPLPLGTFGWPFVGETMAFISSAYSA 219 MDN W +T + I+ R ++S + LPLGT GWPF+GET+ F+S AYS Sbjct: 1 MDNI-WIVFVTVFLLCTVILYRNRLSLMLKSKRKNKLPLGTLGWPFIGETVEFVSCAYSD 59 Query: 220 HPESFMDKRRLKYGK 264 PESFMDKRR YGK Sbjct: 60 RPESFMDKRRRMYGK 74 >gb|ADN34104.1| cytochrome p450 [Cucumis melo subsp. melo] Length = 676 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/64 (54%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Frame = +1 Query: 76 ICISISIIVLYRSWSRI-RSLKTGPLPLGTFGWPFVGETMAFISSAYSAHPESFMDKRRL 252 + ++ I+LYR+ R+ RS LPLG+ GWPF+GET+ FIS AYS PE+FMDKRR Sbjct: 8 LVVTAITIILYRNCFRLLRSKFCNQLPLGSLGWPFIGETIEFISCAYSDRPETFMDKRRR 67 Query: 253 KYGK 264 YGK Sbjct: 68 LYGK 71