BLASTX nr result
ID: Coptis21_contig00030884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030884 (536 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS94977.1| magnesium chelatase H subunit [Fragaria x ananassa] 58 1e-06 ref|XP_004162182.1| PREDICTED: magnesium-chelatase subunit ChlH,... 56 3e-06 ref|XP_004149397.1| PREDICTED: magnesium-chelatase subunit ChlH,... 56 3e-06 gb|AAB97152.1| Mg protoporphyrin IX chelatase [Nicotiana tabacum] 55 7e-06 gb|AFW59876.1| hypothetical protein ZEAMMB73_008702 [Zea mays] 55 7e-06 >gb|ACS94977.1| magnesium chelatase H subunit [Fragaria x ananassa] Length = 1381 Score = 57.8 bits (138), Expect = 1e-06 Identities = 34/60 (56%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +1 Query: 187 VPFIVALLLVCQTN*KVVE*YLRLHPIQVALQVDFP*VNGGVHPIFLS*RDLRTGE-CSF 363 VP+IVAL LV QT + + L LHPIQVALQV P ++GG+ PI + RD RTG+ CSF Sbjct: 416 VPYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGKSCSF 475 >ref|XP_004162182.1| PREDICTED: magnesium-chelatase subunit ChlH, chloroplastic-like [Cucumis sativus] Length = 1382 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +1 Query: 187 VPFIVALLLVCQTN*KVVE*YLRLHPIQVALQVDFP*VNGGVHPIFLS*RDLRTGE 354 VP+IVAL LV QT + + L LHPIQVALQV P ++GG+ PI S RD RTG+ Sbjct: 416 VPYIVALPLVFQTTEEWLNGTLGLHPIQVALQVALPELDGGMEPIVFSGRDPRTGK 471 >ref|XP_004149397.1| PREDICTED: magnesium-chelatase subunit ChlH, chloroplastic-like [Cucumis sativus] Length = 1382 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +1 Query: 187 VPFIVALLLVCQTN*KVVE*YLRLHPIQVALQVDFP*VNGGVHPIFLS*RDLRTGE 354 VP+IVAL LV QT + + L LHPIQVALQV P ++GG+ PI S RD RTG+ Sbjct: 416 VPYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFSGRDPRTGK 471 >gb|AAB97152.1| Mg protoporphyrin IX chelatase [Nicotiana tabacum] Length = 1382 Score = 55.1 bits (131), Expect = 7e-06 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 187 VPFIVALLLVCQTN*KVVE*YLRLHPIQVALQVDFP*VNGGVHPIFLS*RDLRTGE 354 VP+IVAL LV QT + + L LHPIQVALQV P ++GG+ PI + RD RTG+ Sbjct: 416 VPYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGK 471 >gb|AFW59876.1| hypothetical protein ZEAMMB73_008702 [Zea mays] Length = 1379 Score = 55.1 bits (131), Expect = 7e-06 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 187 VPFIVALLLVCQTN*KVVE*YLRLHPIQVALQVDFP*VNGGVHPIFLS*RDLRTGE 354 VP+IVAL LV QT + + L LHPIQVALQV P ++GG+ PI + RD RTG+ Sbjct: 413 VPYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGK 468