BLASTX nr result
ID: Coptis21_contig00030868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030868 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300744.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 ref|XP_003550400.1| PREDICTED: GTPase HflX-like [Glycine max] 72 6e-11 emb|CBI19757.3| unnamed protein product [Vitis vinifera] 71 8e-11 ref|XP_002281042.1| PREDICTED: GTPase HflX-like [Vitis vinifera] 71 8e-11 ref|XP_002510444.1| GTP-binding protein hflx, putative [Ricinus ... 70 2e-10 >ref|XP_002300744.1| predicted protein [Populus trichocarpa] gi|222842470|gb|EEE80017.1| predicted protein [Populus trichocarpa] Length = 211 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 338 LLNTIHQVGLVEGTEYTEKGTLVRTHVPLPLARQLTPMRQLCAS 207 LL+TIHQVG+VE TEYTE GTL++ HVPL AR LTPMRQLCAS Sbjct: 168 LLSTIHQVGMVERTEYTESGTLIKAHVPLRFARLLTPMRQLCAS 211 >ref|XP_003550400.1| PREDICTED: GTPase HflX-like [Glycine max] Length = 529 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -1 Query: 338 LLNTIHQVGLVEGTEYTEKGTLVRTHVPLPLARQLTPMRQLCAS*P 201 LL+TIHQVG+VE TEYTE+GT ++ HVPL AR LTPMRQLC S P Sbjct: 484 LLSTIHQVGMVEKTEYTEQGTYIKAHVPLRFARMLTPMRQLCVSQP 529 >emb|CBI19757.3| unnamed protein product [Vitis vinifera] Length = 561 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 338 LLNTIHQVGLVEGTEYTEKGTLVRTHVPLPLARQLTPMRQLCAS 207 LL+TIHQVG+VE TEYTE GTLV+ HVPL AR LTPMRQLC S Sbjct: 518 LLSTIHQVGMVERTEYTENGTLVKAHVPLRFARLLTPMRQLCKS 561 >ref|XP_002281042.1| PREDICTED: GTPase HflX-like [Vitis vinifera] Length = 547 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 338 LLNTIHQVGLVEGTEYTEKGTLVRTHVPLPLARQLTPMRQLCAS 207 LL+TIHQVG+VE TEYTE GTLV+ HVPL AR LTPMRQLC S Sbjct: 504 LLSTIHQVGMVERTEYTENGTLVKAHVPLRFARLLTPMRQLCKS 547 >ref|XP_002510444.1| GTP-binding protein hflx, putative [Ricinus communis] gi|223551145|gb|EEF52631.1| GTP-binding protein hflx, putative [Ricinus communis] Length = 541 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 338 LLNTIHQVGLVEGTEYTEKGTLVRTHVPLPLARQLTPMRQLC 213 LL+TIHQVG+VE TEYTE GTL++ HVPL AR LTPMRQLC Sbjct: 498 LLSTIHQVGMVERTEYTENGTLIKAHVPLRFARLLTPMRQLC 539