BLASTX nr result
ID: Coptis21_contig00030655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030655 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637626.1| Pentatricopeptide repeat-containing protein ... 72 6e-11 ref|XP_003637381.1| Pentatricopeptide repeat-containing protein ... 72 6e-11 ref|XP_003528450.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-10 ref|XP_002524030.1| pentatricopeptide repeat-containing protein,... 62 5e-08 ref|XP_002307901.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 >ref|XP_003637626.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503561|gb|AES84764.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 989 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/65 (50%), Positives = 47/65 (72%), Gaps = 4/65 (6%) Frame = +1 Query: 1 VEEAVGLLSEMIKRGVEIDCVTCNVLVNWFCQIGLLDNAEEVFMD----GIERDVVGYNT 168 V++ GLLSEM+KRG+ D +TCN+LV +C+IGL+ AE V + G+ +DV+G NT Sbjct: 178 VDQGFGLLSEMVKRGLCFDSITCNILVKGYCRIGLVQYAEWVMYNLVDGGVTKDVIGLNT 237 Query: 169 LVDGY 183 L+DGY Sbjct: 238 LIDGY 242 >ref|XP_003637381.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503316|gb|AES84519.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1023 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/65 (50%), Positives = 47/65 (72%), Gaps = 4/65 (6%) Frame = +1 Query: 1 VEEAVGLLSEMIKRGVEIDCVTCNVLVNWFCQIGLLDNAEEVFMD----GIERDVVGYNT 168 V++ GLLSEM+KRG+ D +TCN+LV +C+IGL+ AE V + G+ +DV+G NT Sbjct: 178 VDQGFGLLSEMVKRGLCFDSITCNILVKGYCRIGLVQYAEWVMYNLVDGGVTKDVIGLNT 237 Query: 169 LVDGY 183 L+DGY Sbjct: 238 LIDGY 242 >ref|XP_003528450.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Glycine max] Length = 1012 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/64 (51%), Positives = 44/64 (68%), Gaps = 4/64 (6%) Frame = +1 Query: 4 EEAVGLLSEMIKRGVEIDCVTCNVLVNWFCQIGLLDNAEEVFMD----GIERDVVGYNTL 171 ++ GLLSEM+K+GV D VTCN+LV +CQIGL+ AE + + G+ D +G NTL Sbjct: 92 DQGFGLLSEMVKKGVCFDSVTCNILVKGYCQIGLVQYAEWIMGNLVGGGVPLDAIGLNTL 151 Query: 172 VDGY 183 VDGY Sbjct: 152 VDGY 155 >ref|XP_002524030.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536757|gb|EEF38398.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1016 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 4/67 (5%) Frame = +1 Query: 1 VEEAVGLLSEMIKRGVEIDCVTCNVLVNWFCQIGLLDNAEEVF----MDGIERDVVGYNT 168 V +A G LS M+K+ D +TCN+LV FC+IGL E + G +DV+G+NT Sbjct: 93 VNQAFGFLSIMVKKDTCFDTITCNILVKGFCRIGLAKYGERIMDNLVSGGTCKDVIGFNT 152 Query: 169 LVDGYFK 189 L+DGY K Sbjct: 153 LIDGYCK 159 >ref|XP_002307901.1| predicted protein [Populus trichocarpa] gi|222853877|gb|EEE91424.1| predicted protein [Populus trichocarpa] Length = 724 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 4/68 (5%) Frame = +1 Query: 1 VEEAVGLLSEMIKRGVEIDCVTCNVLVNWFCQIGLLDNAEEVFMDGIER----DVVGYNT 168 VE+ +GL EMI++G+ +TCN+L+N FC G + NA E D I R D+V YN+ Sbjct: 573 VEKGLGLFEEMIRKGLTPSIITCNILINGFCTAGKVHNALEFMRDMIHRGFSPDIVTYNS 632 Query: 169 LVDGYFKR 192 L++G KR Sbjct: 633 LINGLCKR 640