BLASTX nr result
ID: Coptis21_contig00030623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030623 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26492.3| unnamed protein product [Vitis vinifera] 56 3e-06 emb|CAN79061.1| hypothetical protein VITISV_024577 [Vitis vinifera] 55 5e-06 >emb|CBI26492.3| unnamed protein product [Vitis vinifera] Length = 851 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = +2 Query: 155 SSGSDSNSPPRKVRCIREIYDSCNVAFLACEPGKYEEAATDEKWQKAMDEEINVI 319 SS S +S PRK+R + ++Y CN+ + EP +EEA DE W+KAM++EI+VI Sbjct: 700 SSSSSPSSTPRKMRSLSDVYKRCNLCIV--EPQSFEEAIKDEDWRKAMEKEIDVI 752 >emb|CAN79061.1| hypothetical protein VITISV_024577 [Vitis vinifera] Length = 1424 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/55 (45%), Positives = 38/55 (69%) Frame = +2 Query: 155 SSGSDSNSPPRKVRCIREIYDSCNVAFLACEPGKYEEAATDEKWQKAMDEEINVI 319 S S +S PRK+R + ++Y+ CN+ + EP +EEA DE W+KAM++EI+VI Sbjct: 874 SXSSSPSSTPRKMRSLTDVYERCNLCIV--EPQSFEEAIKDEDWRKAMEKEIDVI 926