BLASTX nr result
ID: Coptis21_contig00030526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030526 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 91 1e-16 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|2... 82 4e-14 ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-13 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 73 2e-11 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/71 (61%), Positives = 53/71 (74%) Frame = -3 Query: 219 LIQKLLGERKLKEALNLLRLMKKHDRPSFEEPFNDYISKFGTVDDAIDYLTALRVNNFPP 40 LI+KLL RKL+EALNLLRLMK+H+ P F EPF YIS+FGTVDDA D+L AL V +P Sbjct: 517 LIEKLLEVRKLEEALNLLRLMKQHNHPPFPEPFVQYISRFGTVDDAADFLKALSVKEYPS 576 Query: 39 VSVYSHAIESF 7 S Y + +SF Sbjct: 577 TSAYLNVFQSF 587 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 86.7 bits (213), Expect = 2e-15 Identities = 42/71 (59%), Positives = 51/71 (71%) Frame = -3 Query: 219 LIQKLLGERKLKEALNLLRLMKKHDRPSFEEPFNDYISKFGTVDDAIDYLTALRVNNFPP 40 +I KLLG RKL+EA+NLL LMKK + P F EPF +YISKFGTV+DA ++L AL +P Sbjct: 519 MINKLLGVRKLEEAINLLHLMKKQNYPPFPEPFIEYISKFGTVEDAGEFLNALSAKKYPS 578 Query: 39 VSVYSHAIESF 7 S Y H ESF Sbjct: 579 QSAYVHVFESF 589 >ref|XP_002321639.1| predicted protein [Populus trichocarpa] gi|222868635|gb|EEF05766.1| predicted protein [Populus trichocarpa] Length = 476 Score = 82.4 bits (202), Expect = 4e-14 Identities = 39/73 (53%), Positives = 52/73 (71%) Frame = -3 Query: 219 LIQKLLGERKLKEALNLLRLMKKHDRPSFEEPFNDYISKFGTVDDAIDYLTALRVNNFPP 40 LI+KLL RKL+EA +LLRLMKKH+ P F EPF+ YISKFGTV+DA+++ L V +P Sbjct: 366 LIEKLLQVRKLEEATDLLRLMKKHNYPPFPEPFDQYISKFGTVEDAVNFFKVLSVKEYPS 425 Query: 39 VSVYSHAIESFCK 1 Y ++SF + Sbjct: 426 SVAYLRMLDSFLR 438 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 79.3 bits (194), Expect = 3e-13 Identities = 41/71 (57%), Positives = 47/71 (66%) Frame = -3 Query: 219 LIQKLLGERKLKEALNLLRLMKKHDRPSFEEPFNDYISKFGTVDDAIDYLTALRVNNFPP 40 LI+ LL RKL+EA+ LLRLMKK + P F EPF YISKFGTV DA D+L L +P Sbjct: 512 LIKNLLEVRKLEEAIALLRLMKKQNYPPFPEPFVQYISKFGTVQDADDFLKVLSSKEYPS 571 Query: 39 VSVYSHAIESF 7 VS Y H SF Sbjct: 572 VSAYLHIFNSF 582 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 73.2 bits (178), Expect = 2e-11 Identities = 38/70 (54%), Positives = 47/70 (67%) Frame = -3 Query: 219 LIQKLLGERKLKEALNLLRLMKKHDRPSFEEPFNDYISKFGTVDDAIDYLTALRVNNFPP 40 LI+KLLG K +EAL LLRLMK H+ P + PF YISKFG+V+DA +L AL V ++P Sbjct: 518 LIEKLLGVMKFEEALELLRLMKSHNYPPYHLPFVPYISKFGSVEDAEAFLKALSVKSYPS 577 Query: 39 VSVYSHAIES 10 VY ES Sbjct: 578 HIVYVQVFES 587