BLASTX nr result
ID: Coptis21_contig00029972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029972 (413 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314711.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002517210.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002314711.1| predicted protein [Populus trichocarpa] gi|222863751|gb|EEF00882.1| predicted protein [Populus trichocarpa] Length = 365 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = +2 Query: 101 VFKGKNKEHAEKNI---AVKKVSTT-KEVIRKYLKKVKPLYDKFSQKQKPEVG 247 VFK +NK N+ +VK++S T KEVIRKY KKVKPLY+K SQKQ+ ++G Sbjct: 167 VFKKENKSRENDNVPGSSVKRISVTAKEVIRKYFKKVKPLYEKLSQKQQQKMG 219 >ref|XP_002517210.1| conserved hypothetical protein [Ricinus communis] gi|223543845|gb|EEF45373.1| conserved hypothetical protein [Ricinus communis] Length = 350 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +2 Query: 113 KNKEHAEKNIAVKKVSTTKEVIRKYLKKVKPLYDKFSQKQKPEVG 247 KN+E+ N + +T KEVIRKYLKKVKPLY+K SQKQ+ ++G Sbjct: 174 KNRENEGSNSVKRMSATAKEVIRKYLKKVKPLYEKLSQKQQQKMG 218