BLASTX nr result
ID: Coptis21_contig00029888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029888 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37064.3| unnamed protein product [Vitis vinifera] 96 3e-18 ref|XP_002274039.1| PREDICTED: probable calcium-activated outwar... 96 3e-18 emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] 96 3e-18 ref|XP_002515189.1| Calcium-activated outward-rectifying potassi... 91 1e-16 ref|XP_002320260.1| outward rectifying potassium channel [Populu... 88 6e-16 >emb|CBI37064.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 95.9 bits (237), Expect = 3e-18 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -3 Query: 290 NNNGFISKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPNLLESH 129 NNNGFISKS+YVIYKLKEMGKI+E D+LQI +QFNKLDP+NSG+ITLP+LLE+H Sbjct: 161 NNNGFISKSEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKITLPDLLENH 214 >ref|XP_002274039.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 5, chloroplastic [Vitis vinifera] Length = 390 Score = 95.9 bits (237), Expect = 3e-18 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -3 Query: 290 NNNGFISKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPNLLESH 129 NNNGFISKS+YVIYKLKEMGKI+E D+LQI +QFNKLDP+NSG+ITLP+LLE+H Sbjct: 336 NNNGFISKSEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKITLPDLLENH 389 >emb|CAN67132.1| hypothetical protein VITISV_040173 [Vitis vinifera] Length = 390 Score = 95.9 bits (237), Expect = 3e-18 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -3 Query: 290 NNNGFISKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPNLLESH 129 NNNGFISKS+YVIYKLKEMGKI+E D+LQI +QFNKLDP+NSG+ITLP+LLE+H Sbjct: 336 NNNGFISKSEYVIYKLKEMGKIAENDVLQICNQFNKLDPNNSGKITLPDLLENH 389 >ref|XP_002515189.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223545669|gb|EEF47173.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 390 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -3 Query: 290 NNNGFISKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPNLLES 132 NNNGFISKS+YVIYKLKEMGKI EKDILQI +QF+KLDP+N G+ITLP+LLE+ Sbjct: 336 NNNGFISKSEYVIYKLKEMGKIGEKDILQICNQFSKLDPNNLGKITLPDLLEN 388 >ref|XP_002320260.1| outward rectifying potassium channel [Populus trichocarpa] gi|222861033|gb|EEE98575.1| outward rectifying potassium channel [Populus trichocarpa] Length = 318 Score = 88.2 bits (217), Expect = 6e-16 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -3 Query: 290 NNNGFISKSDYVIYKLKEMGKISEKDILQIGSQFNKLDPSNSGRITLPNLL 138 NNNGFISKS+YVIYKLKEMGKI EKDILQI +QF+KLDP+N G+ITLP+LL Sbjct: 268 NNNGFISKSEYVIYKLKEMGKIGEKDILQICNQFSKLDPNNLGKITLPDLL 318