BLASTX nr result
ID: Coptis21_contig00029862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029862 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549091.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003622120.1| Pentatricopeptide repeat-containing protein ... 59 5e-07 ref|XP_002336062.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002298642.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_003622123.1| Pentatricopeptide repeat-containing protein ... 57 2e-06 >ref|XP_003549091.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14080-like [Glycine max] Length = 647 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 164 ANGCCGNLKTYNILIRKLSKMGEVEEARCLFNHMLENGL 280 ++GCCGNLKTYNILI+K S++G+ EEA LF HML+ G+ Sbjct: 457 SSGCCGNLKTYNILIQKFSEVGQAEEAHMLFYHMLDKGV 495 >ref|XP_003622120.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355497135|gb|AES78338.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 894 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +2 Query: 164 ANGCCGNLKTYNILIRKLSKMGEVEEARCLFNHMLENGL 280 A+GCCGNLKTYN+LI K K G +EEAR LFN M++ G+ Sbjct: 672 ASGCCGNLKTYNVLIHKFLKEGLIEEARTLFNRMVDKGV 710 >ref|XP_002336062.1| predicted protein [Populus trichocarpa] gi|222869847|gb|EEF06978.1| predicted protein [Populus trichocarpa] Length = 626 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 170 GCCGNLKTYNILIRKLSKMGEVEEARCLFNHMLENGL 280 GC GNLKTYNILI K S++G++EEA LFNHMLE G+ Sbjct: 463 GCGGNLKTYNILIGKFSEIGQIEEATRLFNHMLEKGV 499 >ref|XP_002298642.1| predicted protein [Populus trichocarpa] gi|222845900|gb|EEE83447.1| predicted protein [Populus trichocarpa] Length = 567 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 170 GCCGNLKTYNILIRKLSKMGEVEEARCLFNHMLENGL 280 GC GNLKTYNILI K S++G++EEA LFNHMLE G+ Sbjct: 463 GCGGNLKTYNILIGKFSEIGQIEEATRLFNHMLEKGV 499 >ref|XP_003622123.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355497138|gb|AES78341.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 495 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = +2 Query: 164 ANGCCGNLKTYNILIRKLSKMGEVEEARCLFNHMLENGL 280 A+GCCGNLKTYN+LI K + G +EEAR LFN M++ G+ Sbjct: 299 ASGCCGNLKTYNVLIHKFLEEGLIEEARTLFNRMVDKGV 337