BLASTX nr result
ID: Coptis21_contig00029791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029791 (639 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300388.1| predicted protein [Populus trichocarpa] gi|2... 108 8e-22 emb|CBI39775.3| unnamed protein product [Vitis vinifera] 105 5e-21 ref|XP_002267354.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 ref|XP_004160258.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_004151248.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 >ref|XP_002300388.1| predicted protein [Populus trichocarpa] gi|222847646|gb|EEE85193.1| predicted protein [Populus trichocarpa] Length = 514 Score = 108 bits (270), Expect = 8e-22 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -2 Query: 635 GTPIRIMKNLRVCEDCHAALKLISDIVNREIVVRDRNRFHCFKDGSCSCRDYW 477 GTPIRIMKNLRVCEDCHAALK+IS IV+REI+VRDRNRFHCF+DG CSCRD+W Sbjct: 462 GTPIRIMKNLRVCEDCHAALKIISGIVSREIIVRDRNRFHCFRDGQCSCRDFW 514 >emb|CBI39775.3| unnamed protein product [Vitis vinifera] Length = 599 Score = 105 bits (263), Expect = 5e-21 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -2 Query: 632 TPIRIMKNLRVCEDCHAALKLISDIVNREIVVRDRNRFHCFKDGSCSCRDYW 477 TPIRIMKNLR+CEDCH+A KLIS IVNREIVVRDRNRFHCF D SCSCRDYW Sbjct: 548 TPIRIMKNLRICEDCHSAFKLISAIVNREIVVRDRNRFHCFNDNSCSCRDYW 599 >ref|XP_002267354.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 632 Score = 105 bits (263), Expect = 5e-21 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -2 Query: 632 TPIRIMKNLRVCEDCHAALKLISDIVNREIVVRDRNRFHCFKDGSCSCRDYW 477 TPIRIMKNLR+CEDCH+A KLIS IVNREIVVRDRNRFHCF D SCSCRDYW Sbjct: 581 TPIRIMKNLRICEDCHSAFKLISAIVNREIVVRDRNRFHCFNDNSCSCRDYW 632 >ref|XP_004160258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 583 Score = 103 bits (258), Expect = 2e-20 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 638 PGTPIRIMKNLRVCEDCHAALKLISDIVNREIVVRDRNRFHCFKDGSCSCRDYW 477 PGT IRIMKNLRVCEDCHAALK+IS + REIVVRDRNRFHCFK+GSCSC DYW Sbjct: 530 PGTVIRIMKNLRVCEDCHAALKIISVVSTREIVVRDRNRFHCFKNGSCSCGDYW 583 >ref|XP_004151248.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cucumis sativus] Length = 617 Score = 103 bits (258), Expect = 2e-20 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -2 Query: 638 PGTPIRIMKNLRVCEDCHAALKLISDIVNREIVVRDRNRFHCFKDGSCSCRDYW 477 PGT IRIMKNLRVCEDCHAALK+IS + REIVVRDRNRFHCFK+GSCSC DYW Sbjct: 564 PGTVIRIMKNLRVCEDCHAALKIISVVSTREIVVRDRNRFHCFKNGSCSCGDYW 617