BLASTX nr result
ID: Coptis21_contig00029604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029604 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529154.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002281785.1| PREDICTED: uncharacterized protein LOC100247... 60 2e-07 ref|XP_002893575.1| hypothetical protein ARALYDRAFT_473173 [Arab... 58 9e-07 ref|XP_002312382.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|NP_564334.1| metallo-beta-lactamase domain-containing protei... 56 3e-06 >ref|XP_002529154.1| conserved hypothetical protein [Ricinus communis] gi|223531433|gb|EEF33267.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -2 Query: 225 RSEGTMESFKELLSKEVPDAEVLEPAPGVPLEILAP 118 RSEGT+ESFKELL+KE+PD+ VLEP PGVPL+I AP Sbjct: 301 RSEGTIESFKELLAKELPDSRVLEPTPGVPLQISAP 336 >ref|XP_002281785.1| PREDICTED: uncharacterized protein LOC100247534 [Vitis vinifera] gi|297737856|emb|CBI27057.3| unnamed protein product [Vitis vinifera] Length = 340 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 225 RSEGTMESFKELLSKEVPDAEVLEPAPGVPLEILAP 118 +SEGT+ESFKELL KE+PDA++LEP PGVPLEI P Sbjct: 301 QSEGTVESFKELLHKELPDAQILEPTPGVPLEISPP 336 >ref|XP_002893575.1| hypothetical protein ARALYDRAFT_473173 [Arabidopsis lyrata subsp. lyrata] gi|297339417|gb|EFH69834.1| hypothetical protein ARALYDRAFT_473173 [Arabidopsis lyrata subsp. lyrata] Length = 350 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -2 Query: 225 RSEGTMESFKELLSKEVPDAEVLEPAPGVPLEILAP 118 + EGT+ESFKELL KE+P+A+VLEP G+PLEILAP Sbjct: 311 KKEGTIESFKELLLKELPEAQVLEPIAGIPLEILAP 346 >ref|XP_002312382.1| predicted protein [Populus trichocarpa] gi|222852202|gb|EEE89749.1| predicted protein [Populus trichocarpa] Length = 345 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 225 RSEGTMESFKELLSKEVPDAEVLEPAPGVPLEILAP 118 ++EGT+ESFKELL+KE+PD + LEP PGVPLEI P Sbjct: 310 QAEGTVESFKELLAKELPDTQALEPTPGVPLEISEP 345 >ref|NP_564334.1| metallo-beta-lactamase domain-containing protein [Arabidopsis thaliana] gi|12321412|gb|AAG50777.1|AC079288_6 unknown protein [Arabidopsis thaliana] gi|12323515|gb|AAG51727.1|AC068667_6 unknown protein; 129333-127623 [Arabidopsis thaliana] gi|14596083|gb|AAK68769.1| Unknown protein [Arabidopsis thaliana] gi|18377530|gb|AAL66931.1| unknown protein [Arabidopsis thaliana] gi|332192998|gb|AEE31119.1| metallo-beta-lactamase domain-containing protein [Arabidopsis thaliana] Length = 350 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 225 RSEGTMESFKELLSKEVPDAEVLEPAPGVPLEILAP 118 + EGT+ESFKELL KE+P+A+VLEP G+PLEIL P Sbjct: 311 KKEGTIESFKELLLKELPEAQVLEPIAGIPLEILVP 346