BLASTX nr result
ID: Coptis21_contig00029554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029554 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160350.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_004137884.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_002278166.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 emb|CAN82226.1| hypothetical protein VITISV_011875 [Vitis vinifera] 56 4e-06 ref|XP_002303738.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_004160350.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Length = 429 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +1 Query: 181 ALRVLDEIPHTDTFAWNSIIQTHLSNADLRLALLVYPQMLLRGVR 315 A +V D+IP DTFAWN++IQTHL+N DL + Y QML RGVR Sbjct: 12 AHQVFDDIPIWDTFAWNNLIQTHLTNGDLGHVISTYRQMLFRGVR 56 >ref|XP_004137884.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Length = 629 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +1 Query: 181 ALRVLDEIPHTDTFAWNSIIQTHLSNADLRLALLVYPQMLLRGVR 315 A +V D+IP DTFAWN++IQTHL+N DL + Y QML RGVR Sbjct: 12 AHQVFDDIPIWDTFAWNNLIQTHLTNGDLGHVISTYRQMLFRGVR 56 >ref|XP_002278166.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Vitis vinifera] Length = 662 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +1 Query: 187 RVLDEIPHTDTFAWNSIIQTHLSNADLRLALLVYPQMLLRGVR 315 ++ DEIP ++TFAWN++IQTHL+N D + Y QMLLRGVR Sbjct: 48 QLFDEIPVSNTFAWNNLIQTHLTNGDSDRVVSTYRQMLLRGVR 90 >emb|CAN82226.1| hypothetical protein VITISV_011875 [Vitis vinifera] Length = 734 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +1 Query: 187 RVLDEIPHTDTFAWNSIIQTHLSNADLRLALLVYPQMLLRGVR 315 ++ DEIP ++TFAWN++IQTHL+N D + Y QMLLRGVR Sbjct: 143 QLFDEIPVSNTFAWNNLIQTHLTNGDSGRVVSTYRQMLLRGVR 185 >ref|XP_002303738.1| predicted protein [Populus trichocarpa] gi|222841170|gb|EEE78717.1| predicted protein [Populus trichocarpa] Length = 663 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +1 Query: 187 RVLDEIPHTDTFAWNSIIQTHLSNADLRLALLVYPQMLLRG 309 +VLDEIP +DTFAWN++I THLSN D AL +Y M++RG Sbjct: 49 KVLDEIPLSDTFAWNNLIHTHLSNRDPGGALSIYHHMMMRG 89