BLASTX nr result
ID: Coptis21_contig00028325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028325 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322694.1| predicted protein [Populus trichocarpa] gi|2... 124 6e-27 ref|NP_187990.1| pentatricopeptide repeat-containing protein [Ar... 123 2e-26 ref|XP_002882843.1| pentatricopeptide repeat-containing protein ... 122 4e-26 gb|AFW87472.1| hypothetical protein ZEAMMB73_326917 [Zea mays] 119 3e-25 ref|XP_002438673.1| hypothetical protein SORBIDRAFT_10g024090 [S... 119 3e-25 >ref|XP_002322694.1| predicted protein [Populus trichocarpa] gi|222867324|gb|EEF04455.1| predicted protein [Populus trichocarpa] Length = 586 Score = 124 bits (312), Expect = 6e-27 Identities = 53/75 (70%), Positives = 64/75 (85%) Frame = -1 Query: 298 ERMLLSHSEKLAIALGLIGTCSGVPIKVMKNLRICVDCHNFAKFVSKICKREISLRDSKR 119 E++LL HSEKLA+A GLI T GVP++V+KNLRICVDCHNFAKFVSK+ R++S+RD R Sbjct: 512 EKILLGHSEKLALAFGLISTSEGVPLRVIKNLRICVDCHNFAKFVSKVYGRQVSIRDKNR 571 Query: 118 FHHIVEGICSCGDYW 74 FHH+ GICSCGDYW Sbjct: 572 FHHVAGGICSCGDYW 586 >ref|NP_187990.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75273354|sp|Q9LIC3.1|PP227_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial; Flags: Precursor gi|9294022|dbj|BAB01925.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332641888|gb|AEE75409.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 628 Score = 123 bits (308), Expect = 2e-26 Identities = 54/75 (72%), Positives = 62/75 (82%) Frame = -1 Query: 298 ERMLLSHSEKLAIALGLIGTCSGVPIKVMKNLRICVDCHNFAKFVSKICKREISLRDSKR 119 E+MLL HSEKLA+ GLI T G+PI+V KNLRICVDCHNFAK SK+ +RE+SLRD R Sbjct: 554 EKMLLGHSEKLALTFGLIATGEGIPIRVFKNLRICVDCHNFAKIFSKVFEREVSLRDKNR 613 Query: 118 FHHIVEGICSCGDYW 74 FH IV+GICSCGDYW Sbjct: 614 FHQIVDGICSCGDYW 628 >ref|XP_002882843.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328683|gb|EFH59102.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 627 Score = 122 bits (305), Expect = 4e-26 Identities = 54/75 (72%), Positives = 62/75 (82%) Frame = -1 Query: 298 ERMLLSHSEKLAIALGLIGTCSGVPIKVMKNLRICVDCHNFAKFVSKICKREISLRDSKR 119 E+MLL HSEKLA+ GLI T G+PI+V KNLRICVDCHNFAK SK+ +RE+SLRD R Sbjct: 553 EKMLLGHSEKLALTFGLITTGEGIPIRVFKNLRICVDCHNFAKIFSKVFEREVSLRDKNR 612 Query: 118 FHHIVEGICSCGDYW 74 FH IV+GICSCGDYW Sbjct: 613 FHQIVKGICSCGDYW 627 >gb|AFW87472.1| hypothetical protein ZEAMMB73_326917 [Zea mays] Length = 610 Score = 119 bits (298), Expect = 3e-25 Identities = 56/75 (74%), Positives = 61/75 (81%) Frame = -1 Query: 298 ERMLLSHSEKLAIALGLIGTCSGVPIKVMKNLRICVDCHNFAKFVSKICKREISLRDSKR 119 ERMLL HSEKLAI GL+ T S + I+VMKNLRICVDCHNFAKFVSK+ REISLRD R Sbjct: 536 ERMLLGHSEKLAITFGLMSTPSDLTIQVMKNLRICVDCHNFAKFVSKVYGREISLRDKNR 595 Query: 118 FHHIVEGICSCGDYW 74 FH I EG C+CGDYW Sbjct: 596 FHLITEGACTCGDYW 610 >ref|XP_002438673.1| hypothetical protein SORBIDRAFT_10g024090 [Sorghum bicolor] gi|241916896|gb|EER90040.1| hypothetical protein SORBIDRAFT_10g024090 [Sorghum bicolor] Length = 588 Score = 119 bits (298), Expect = 3e-25 Identities = 56/75 (74%), Positives = 61/75 (81%) Frame = -1 Query: 298 ERMLLSHSEKLAIALGLIGTCSGVPIKVMKNLRICVDCHNFAKFVSKICKREISLRDSKR 119 ERMLL HSEKLAI GL+ T S + I+VMKNLRICVDCHNFAKFVSK+ REISLRD R Sbjct: 514 ERMLLGHSEKLAITFGLMSTPSDLTIQVMKNLRICVDCHNFAKFVSKVYGREISLRDKNR 573 Query: 118 FHHIVEGICSCGDYW 74 FH I EG C+CGDYW Sbjct: 574 FHLITEGACTCGDYW 588