BLASTX nr result
ID: Coptis21_contig00028246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028246 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517852.1| homeobox protein, putative [Ricinus communis... 95 7e-18 emb|CBI21902.3| unnamed protein product [Vitis vinifera] 93 3e-17 ref|XP_002275272.1| PREDICTED: uncharacterized protein LOC100250... 93 3e-17 emb|CAN73827.1| hypothetical protein VITISV_003176 [Vitis vinifera] 93 3e-17 ref|XP_003566982.1| PREDICTED: uncharacterized protein LOC100827... 87 1e-15 >ref|XP_002517852.1| homeobox protein, putative [Ricinus communis] gi|223542834|gb|EEF44370.1| homeobox protein, putative [Ricinus communis] Length = 1784 Score = 94.7 bits (234), Expect = 7e-18 Identities = 44/52 (84%), Positives = 47/52 (90%) Frame = +1 Query: 1 EQTYLVETYPSEALRAELSEKLGLTDRQLQMWFCHRRLKDRKNVPVKRQKKD 156 E+TY VETYPSE LRAELS +LGLTDRQLQMWFCHRRLKDRK PVKRQ+KD Sbjct: 39 EKTYAVETYPSEELRAELSAQLGLTDRQLQMWFCHRRLKDRKGPPVKRQRKD 90 >emb|CBI21902.3| unnamed protein product [Vitis vinifera] Length = 1870 Score = 92.8 bits (229), Expect = 3e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = +1 Query: 1 EQTYLVETYPSEALRAELSEKLGLTDRQLQMWFCHRRLKDRKNVPVKRQKKD 156 E+TY VETYPSE LRAELS KLGL+DRQLQMWFCHRRLKDRK PVKR +KD Sbjct: 33 EKTYAVETYPSETLRAELSAKLGLSDRQLQMWFCHRRLKDRKTPPVKRPRKD 84 >ref|XP_002275272.1| PREDICTED: uncharacterized protein LOC100250601 [Vitis vinifera] Length = 1772 Score = 92.8 bits (229), Expect = 3e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = +1 Query: 1 EQTYLVETYPSEALRAELSEKLGLTDRQLQMWFCHRRLKDRKNVPVKRQKKD 156 E+TY VETYPSE LRAELS KLGL+DRQLQMWFCHRRLKDRK PVKR +KD Sbjct: 33 EKTYAVETYPSETLRAELSAKLGLSDRQLQMWFCHRRLKDRKTPPVKRPRKD 84 >emb|CAN73827.1| hypothetical protein VITISV_003176 [Vitis vinifera] Length = 533 Score = 92.8 bits (229), Expect = 3e-17 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = +1 Query: 1 EQTYLVETYPSEALRAELSEKLGLTDRQLQMWFCHRRLKDRKNVPVKRQKKD 156 E+TY VETYPSE LRAELS KLGL+DRQLQMWFCHRRLKDRK PVKR +KD Sbjct: 235 EKTYAVETYPSETLRAELSAKLGLSDRQLQMWFCHRRLKDRKTPPVKRPRKD 286 >ref|XP_003566982.1| PREDICTED: uncharacterized protein LOC100827669 [Brachypodium distachyon] Length = 1845 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = +1 Query: 1 EQTYLVETYPSEALRAELSEKLGLTDRQLQMWFCHRRLKDRKNVPVKRQKKD 156 EQTYL E YPSEA+RAELS K+GL+DRQLQMWFCHRRLKDRK P KRQ++D Sbjct: 64 EQTYLAEQYPSEAMRAELSVKIGLSDRQLQMWFCHRRLKDRK-PPAKRQRRD 114