BLASTX nr result
ID: Coptis21_contig00028243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028243 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320885.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 ref|XP_002523293.1| ATP synthase delta chain, putative [Ricinus ... 66 3e-09 ref|XP_004134294.1| PREDICTED: ATP synthase delta chain, chlorop... 57 1e-06 >ref|XP_002320885.1| predicted protein [Populus trichocarpa] gi|222861658|gb|EEE99200.1| predicted protein [Populus trichocarpa] Length = 275 Score = 68.2 bits (165), Expect = 7e-10 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 9/100 (9%) Frame = +1 Query: 7 RPTSFFPNKAPVFTSPF---NYTTPI------SSLKAALPIVNRKATSGYAAALLDIARC 159 +PTS N+ P T N P+ SS + P +R SGYAAAL+DIARC Sbjct: 82 KPTSSISNRTPSKTKTLSFKNLNLPLFSNISQSSSHNSSPHSHRNPVSGYAAALVDIARC 141 Query: 160 DNTLDIVDKDVRRLSRLLHNADIRAIMVNPLINANVKGRV 279 ++LDIV DV++L +LL N I+A++ +P + KG+V Sbjct: 142 KSSLDIVQNDVQKLLKLLQNEQIQAVLGSPFVGDKEKGQV 181 >ref|XP_002523293.1| ATP synthase delta chain, putative [Ricinus communis] gi|223537381|gb|EEF39009.1| ATP synthase delta chain, putative [Ricinus communis] Length = 227 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/61 (50%), Positives = 45/61 (73%) Frame = +1 Query: 97 PIVNRKATSGYAAALLDIARCDNTLDIVDKDVRRLSRLLHNADIRAIMVNPLINANVKGR 276 P ++ +GYAAALLDIA+ +N+L+ V+KDV+RLS+LL N I+ I++NPL+ KG Sbjct: 73 PNTHQNPATGYAAALLDIAQFNNSLETVEKDVKRLSKLLRNEQIQCILINPLVGDKEKGL 132 Query: 277 V 279 V Sbjct: 133 V 133 >ref|XP_004134294.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Cucumis sativus] gi|449478221|ref|XP_004155254.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Cucumis sativus] Length = 227 Score = 57.4 bits (137), Expect = 1e-06 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 15/105 (14%) Frame = +1 Query: 10 PTSFFPNKAPVFTS-----PFNYTTPISSLKAALP----------IVNRKATSGYAAALL 144 PT+ P+++P TS P N+ + +L ++P +++R+ SGYAAALL Sbjct: 32 PTAHLPHRSPSRTSNSISKPPNFLSTPQTLNPSIPFSTPRRSSSPLLHRRPASGYAAALL 91 Query: 145 DIARCDNTLDIVDKDVRRLSRLLHNADIRAIMVNPLINANVKGRV 279 D ++ T+ V KDV R S+LL I ++ +PL+ KGR+ Sbjct: 92 DASQSTGTIHSVAKDVGRFSKLLRGKRIGRVLNDPLVGDEEKGRL 136